| DOT Name |
T-cell surface glycoprotein CD4 (CD4)
|
| Synonyms |
T-cell surface antigen T4/Leu-3; CD antigen CD4 |
| Gene Name |
CD4
|
| Related Disease |
- Immunodeficiency 79 ( )
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
1CDH ; 1CDI ; 1CDJ ; 1CDU ; 1CDY ; 1G9M ; 1G9N ; 1GC1 ; 1JL4 ; 1Q68 ; 1RZJ ; 1RZK ; 1WBR ; 1WIO ; 1WIP ; 1WIQ ; 2B4C ; 2JKR ; 2JKT ; 2KLU ; 2NXY ; 2NXZ ; 2NY0 ; 2NY1 ; 2NY2 ; 2NY3 ; 2NY4 ; 2NY5 ; 2NY6 ; 2QAD ; 3B71 ; 3CD4 ; 3J70 ; 3JCB ; 3JCC ; 3JWD ; 3JWO ; 3LQA ; 3O2D ; 3S4S ; 3S5L ; 3T0E ; 4H8W ; 4JM2 ; 4P9H ; 4Q6I ; 4R2G ; 4R4H ; 4RQS ; 5A7X ; 5A8H ; 5CAY ; 5THR ; 5U1F ; 5VN3 ; 6CM3 ; 6EDU ; 6L1Y ; 6MEO ; 6MET ; 6OPN ; 6OPO ; 6OPP ; 6OPQ ; 6QH6 ; 6QH7 ; 6U0L ; 6U0N ; 6URI ; 6X5B ; 6X5C ; 7T0O ; 7T0R ; 7TXD ; 8D5C ; 8FYI ; 8FYJ
|
| Pfam ID |
PF05790
; PF09191
; PF00047
; PF12104
|
| Sequence |
MNRGVPFRHLLLVLQLALLPAATQGKKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIK ILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQL LVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSG TWTCTVLQNQKKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWW QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA LEAKTGKLHQEVNLVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKEAKVSKREKAVWV LNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI
|
| Function |
Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class II molecule:peptide complex. The antigens presented by class II peptides are derived from extracellular proteins while class I peptides are derived from cytosolic proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class II presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of T-helper cells. In other cells such as macrophages or NK cells, plays a role in differentiation/activation, cytokine expression and cell migration in a TCR/LCK-independent pathway. Participates in the development of T-helper cells in the thymus and triggers the differentiation of monocytes into functional mature macrophages; (Microbial infection) Primary receptor for human immunodeficiency virus-1 (HIV-1). Down-regulated by HIV-1 Vpu. Acts as a receptor for Human Herpes virus 7/HHV-7.
|
| Tissue Specificity |
Highly expressed in T-helper cells. The presence of CD4 is a hallmark of T-helper cells which are specialized in the activation and growth of cytotoxic T-cells, regulation of B cells, or activation of phagocytes. CD4 is also present in other immune cells such as macrophages, dendritic cells or NK cells.
|
| KEGG Pathway |
- Viral life cycle - HIV-1 (hsa03250 )
- Virion - Human immunodeficiency virus (hsa03260 )
- Cytokine-cytokine receptor interaction (hsa04060 )
- Cell adhesion molecules (hsa04514 )
- Antigen processing and presentation (hsa04612 )
- Hematopoietic cell lineage (hsa04640 )
- Th1 and Th2 cell differentiation (hsa04658 )
- Th17 cell differentiation (hsa04659 )
- T cell receptor sig.ling pathway (hsa04660 )
- Yersinia infection (hsa05135 )
- Human T-cell leukemia virus 1 infection (hsa05166 )
- Human immunodeficiency virus 1 infection (hsa05170 )
- PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235 )
- Primary immunodeficiency (hsa05340 )
|
| Reactome Pathway |
- Nef Mediated CD4 Down-regulation (R-HSA-167590 )
- Binding and entry of HIV virion (R-HSA-173107 )
- Vpu mediated degradation of CD4 (R-HSA-180534 )
- Downstream TCR signaling (R-HSA-202424 )
- Phosphorylation of CD3 and TCR zeta chains (R-HSA-202427 )
- Translocation of ZAP-70 to Immunological synapse (R-HSA-202430 )
- Generation of second messenger molecules (R-HSA-202433 )
- PD-1 signaling (R-HSA-389948 )
- Other interleukin signaling (R-HSA-449836 )
- Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825 )
- Clathrin-mediated endocytosis (R-HSA-8856828 )
- Alpha-defensins (R-HSA-1462054 )
|
|
|
|
|
|
|