Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT81X593)

DOT Name Cell adhesion molecule-related/down-regulated by oncogenes (CDON)
Gene Name CDON
Related Disease
Bacteremia ( )
Chronic renal failure ( )
Holoprosencephaly 11 ( )
Coloboma ( )
Gastrointestinal stromal tumour ( )
Hypopituitarism ( )
Prostate cancer ( )
Prostate carcinoma ( )
Pituitary stalk interruption syndrome ( )
Holoprosencephaly ( )
UniProt ID
CDON_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3D1M; 3N1F; 3N1Q
Pfam ID
PF00041 ; PF07679 ; PF13927
Sequence
MHPDLGPLCTLLYVTLTILCSSVSSDLAPYFTSEPLSAVQKLGGPVVLHCSAQPVTTRIS
WLHNGKTLDGNLEHVKIHQGTLTILSLNSSLLGYYQCLANNSIGAIVSGPATVSVAVLGD
FGSSTKHVITAEEKSAGFIGCRVPESNPKAEVRYKIRGKWLEHSTENYLILPSGNLQILN
VSLEDKGSYKCAAYNPVTHQLKVEPIGRKLLVSRPSSDDVHILHPTHSQALAVLSRSPVT
LECVVSGVPAPQVYWLKDGQDIAPGSNWRRLYSHLATDSVDPADSGNYSCMAGNKSGDVK
YVTYMVNVLEHASISKGLQDQIVSLGATVHFTCDVHGNPAPNCTWFHNAQPIHPSARHLT
AGNGLKISGVTVEDVGMYQCVADNGIGFMHSTGRLEIENDGGFKPVIITAPVSAKVADGD
FVTLSCNASGLPVPVIRWYDSHGLITSHPSQVLRSKSRKSQLSRPEGLNLEPVYFVLSQA
GASSLHIQAVTQEHAGKYICEAANEHGTTQAEASLMVVPFETNTKAETVTLPDAAQNDDR
SKRDGSETGLLSSFPVKVHPSAVESAPEKNASGISVPDAPIILSPPQTHTPDTYNLVWRA
GKDGGLPINAYFVKYRKLDDGVGMLGSWHTVRVPGSENELHLAELEPSSLYEVLMVARSA
AGEGQPAMLTFRTSKEKTASSKNTQASSPPVGIPKYPVVSEAANNNFGVVLTDSSRHSGV
PEAPDRPTISTASETSVYVTWIPRANGGSPITAFKVEYKRMRTSNWLVAAEDIPPSKLSV
EVRSLEPGSTYKFRVIAINHYGESFRSSASRPYQVVGFPNRFSSRPITGPHIAYTEAVSD
TQIMLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHMIGHLQPETSY
DIKMQCFNEGGESEFSNVMICETKVKRVPGASEYPVKDLSTPPNSLGSGGNVGPATSPAR
SSDMLYLIVGCVLGVMVLILMVFIAMCLWKNRQQNTIQKYDPPGYLYQGSDMNGQMVDYT
TLSGASQINGNVHGGFLTNGGLSSGYSHLHHKVPNAVNGIVNGSLNGGLYSGHSNSLTRT
HVDFEHPHHLVNGGGMYTAVPQIDPLECVNCRNCRNNNRCFTKTNSTFSSSPPPVVPVVA
PYPQDGLEMKPLSHVKVPVCLTSAVPDCGQLPEESVKDNVEPVPTQRTCCQDIVNDVSSD
GSEDPAEFSRGQEGMINLRIPDHLQLAKSCVWEGDSCAHSETEINIVSWNALILPPVPEG
CAEKTMWSPPGIPLDSPTEVLQQPRET
Function Component of a cell-surface receptor complex that mediates cell-cell interactions between muscle precursor cells. Promotes differentiation of myogenic cells.
KEGG Pathway
Hedgehog sig.ling pathway (hsa04340 )
Reactome Pathway
Ligand-receptor interactions (R-HSA-5632681 )
Activation of SMO (R-HSA-5635838 )
Myogenesis (R-HSA-525793 )

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Bacteremia DIS6N9RZ Definitive Biomarker [1]
Chronic renal failure DISGG7K6 Definitive Genetic Variation [2]
Holoprosencephaly 11 DIS6U5EL Definitive Autosomal dominant [3]
Coloboma DISP39N5 Strong Biomarker [4]
Gastrointestinal stromal tumour DIS6TJYS Strong Biomarker [5]
Hypopituitarism DIS1QT3G Strong Genetic Variation [6]
Prostate cancer DISF190Y moderate Altered Expression [7]
Prostate carcinoma DISMJPLE moderate Altered Expression [7]
Pituitary stalk interruption syndrome DISGSN5T Supportive Autosomal dominant [8]
Holoprosencephaly DISR35EC Limited Biomarker [4]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Cell adhesion molecule-related/down-regulated by oncogenes (CDON). [9]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Cell adhesion molecule-related/down-regulated by oncogenes (CDON). [20]
------------------------------------------------------------------------------------
14 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Cell adhesion molecule-related/down-regulated by oncogenes (CDON). [10]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Cell adhesion molecule-related/down-regulated by oncogenes (CDON). [11]
Estradiol DMUNTE3 Approved Estradiol affects the expression of Cell adhesion molecule-related/down-regulated by oncogenes (CDON). [12]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Cell adhesion molecule-related/down-regulated by oncogenes (CDON). [13]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Cell adhesion molecule-related/down-regulated by oncogenes (CDON). [14]
Triclosan DMZUR4N Approved Triclosan increases the expression of Cell adhesion molecule-related/down-regulated by oncogenes (CDON). [15]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Cell adhesion molecule-related/down-regulated by oncogenes (CDON). [16]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Cell adhesion molecule-related/down-regulated by oncogenes (CDON). [13]
Irinotecan DMP6SC2 Approved Irinotecan decreases the expression of Cell adhesion molecule-related/down-regulated by oncogenes (CDON). [17]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Cell adhesion molecule-related/down-regulated by oncogenes (CDON). [18]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate increases the expression of Cell adhesion molecule-related/down-regulated by oncogenes (CDON). [19]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Cell adhesion molecule-related/down-regulated by oncogenes (CDON). [21]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Cell adhesion molecule-related/down-regulated by oncogenes (CDON). [22]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Cell adhesion molecule-related/down-regulated by oncogenes (CDON). [23]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Drug(s)

References

1 Complex host genetic susceptibility to Staphylococcus aureus infections.Trends Microbiol. 2015 Sep;23(9):529-36. doi: 10.1016/j.tim.2015.05.008. Epub 2015 Jun 22.
2 Genetics of Chronic Kidney Disease Stages Across Ancestries: The PAGE Study.Front Genet. 2019 May 24;10:494. doi: 10.3389/fgene.2019.00494. eCollection 2019.
3 Mutations in CDON, encoding a hedgehog receptor, result in holoprosencephaly and defective interactions with other hedgehog receptors. Am J Hum Genet. 2011 Aug 12;89(2):231-40. doi: 10.1016/j.ajhg.2011.07.001. Epub 2011 Jul 28.
4 Homozygous variants in MAPRE2 and CDON in individual with skin folds, growth delay, retinal coloboma, and pyloric stenosis.Am J Med Genet A. 2019 Dec;179(12):2454-2458. doi: 10.1002/ajmg.a.61355. Epub 2019 Sep 9.
5 Hedgehog pathway dysregulation contributes to the pathogenesis of human gastrointestinal stromal tumors via GLI-mediated activation of KIT expression. Oncotarget. 2016 Nov 29;7(48):78226-78241. doi: 10.18632/oncotarget.12909.
6 Classical and non-classical causes of GH deficiency in the paediatric age.Best Pract Res Clin Endocrinol Metab. 2016 Dec;30(6):705-736. doi: 10.1016/j.beem.2016.11.008. Epub 2016 Nov 24.
7 Identification of transmembrane protein in prostate cancer by the Escherichia coli ampicillin secretion trap: expression of CDON is involved in tumor cell growth and invasion.Pathobiology. 2011;78(5):277-84. doi: 10.1159/000329588. Epub 2011 Aug 17.
8 A Nonsense Mutation in the Hedgehog Receptor CDON Associated With Pituitary Stalk Interruption Syndrome. J Clin Endocrinol Metab. 2016 Jan;101(1):12-5. doi: 10.1210/jc.2015-2995. Epub 2015 Nov 3.
9 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
10 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
11 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
12 Estradiol and selective estrogen receptor modulators differentially regulate target genes with estrogen receptors alpha and beta. Mol Biol Cell. 2004 Mar;15(3):1262-72. doi: 10.1091/mbc.e03-06-0360. Epub 2003 Dec 29.
13 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
14 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
15 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
16 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
17 Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
18 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
19 Application of the adverse outcome pathway concept for investigating developmental neurotoxicity potential of Chinese herbal medicines by using human neural progenitor cells in vitro. Cell Biol Toxicol. 2023 Feb;39(1):319-343. doi: 10.1007/s10565-022-09730-4. Epub 2022 Jun 15.
20 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
21 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
22 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
23 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.