Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8DXIAT)

• DOT Name: UPF0461 protein C5orf24 (C5ORF24)
• Gene Name: C5ORF24
• UniProt ID: CE024_HUMAN
• Pfam ID: PF17724
• Sequence:
  MMHPVASSNPAFCGPGKPSCLNEDAMRAADQFDIYSSQQSKYSHTVNHKPMVCQRQDPLN
  ETHLQTTSGRSIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKT
  SPGRPLGTTKAAGYKVSPGRPPGSIKALSRLADLGYGCGTAAFPYPMMHGRAVHGVEETS
  SEVKPPNE

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of UPF0461 protein C5orf24 (C5ORF24).	[1]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of UPF0461 protein C5orf24 (C5ORF24).	[2]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of UPF0461 protein C5orf24 (C5ORF24).	[3]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of UPF0461 protein C5orf24 (C5ORF24).	[4]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of UPF0461 protein C5orf24 (C5ORF24).	[5]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of UPF0461 protein C5orf24 (C5ORF24).	[8]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of UPF0461 protein C5orf24 (C5ORF24).	[9]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of UPF0461 protein C5orf24 (C5ORF24).	[5]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of UPF0461 protein C5orf24 (C5ORF24).	[6]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of UPF0461 protein C5orf24 (C5ORF24).	[7]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [3] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [4] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [5] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [8] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [9] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.