Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8P2IFT)

DOT Name B-cell CLL/lymphoma 7 protein family member C (BCL7C)
Gene Name BCL7C
Related Disease
Advanced cancer ( )
Ependymoma ( )
Lewy body dementia ( )
UniProt ID
BCL7C_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF04714
Sequence
MAGRTVRAETRSRAKDDIKKVMATIEKVRRWEKRWVTVGDTSLRIFKWVPVVDPQEEERR
RAGGGAERSRGRERRGRGASPRGGGPLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQ
PSRPVSPAGPPEGVPEEAQPPRLGQERDPGGITAGSTDEPPMLTKEEPVPELLEAEAPEA
YPVFEPVPPVPEAAQGDTEDSEGAPPLKRICPNAPDP
Function May play an anti-apoptotic role.
Tissue Specificity Ubiquitous.
KEGG Pathway
ATP-dependent chromatin remodeling (hsa03082 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Biomarker [1]
Ependymoma DISUMRNZ Strong Biomarker [2]
Lewy body dementia DISAE66J moderate Genetic Variation [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of B-cell CLL/lymphoma 7 protein family member C (BCL7C). [4]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of B-cell CLL/lymphoma 7 protein family member C (BCL7C). [11]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of B-cell CLL/lymphoma 7 protein family member C (BCL7C). [11]
------------------------------------------------------------------------------------
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of B-cell CLL/lymphoma 7 protein family member C (BCL7C). [5]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of B-cell CLL/lymphoma 7 protein family member C (BCL7C). [6]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of B-cell CLL/lymphoma 7 protein family member C (BCL7C). [7]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of B-cell CLL/lymphoma 7 protein family member C (BCL7C). [8]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of B-cell CLL/lymphoma 7 protein family member C (BCL7C). [9]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of B-cell CLL/lymphoma 7 protein family member C (BCL7C). [10]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of B-cell CLL/lymphoma 7 protein family member C (BCL7C). [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 The BCL7 gene family: deletion of BCL7B in Williams syndrome.Gene. 1998 Dec 11;224(1-2):35-44. doi: 10.1016/s0378-1119(98)00514-9.
2 An in vivo screen identifies ependymoma oncogenes and tumor-suppressor genes.Nat Genet. 2015 Aug;47(8):878-87. doi: 10.1038/ng.3323. Epub 2015 Jun 15.
3 Investigating the genetic architecture of dementia with Lewy bodies: a two-stage genome-wide association study.Lancet Neurol. 2018 Jan;17(1):64-74. doi: 10.1016/S1474-4422(17)30400-3. Epub 2017 Dec 16.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
6 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
7 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
8 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
9 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
10 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
11 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
12 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.