Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8YB76N)

DOT Name Mitotic-spindle organizing protein 2B (MZT2B)
Synonyms Mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2B
Gene Name MZT2B
UniProt ID
MZT2B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF12926
Sequence
MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGAIDPDVFKILV
DLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRNKGSAALGGALA
LAERSSREGSSQRMPRQPSATRLPKGGGPGKSPTRGST
Reactome Pathway
Recruitment of NuMA to mitotic centrosomes (R-HSA-380320 )
Recruitment of mitotic centrosome proteins and complexes (R-HSA-380270 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Mitotic-spindle organizing protein 2B (MZT2B). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Mitotic-spindle organizing protein 2B (MZT2B). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Mitotic-spindle organizing protein 2B (MZT2B). [3]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Mitotic-spindle organizing protein 2B (MZT2B). [4]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the expression of Mitotic-spindle organizing protein 2B (MZT2B). [5]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Mitotic-spindle organizing protein 2B (MZT2B). [6]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Mitotic-spindle organizing protein 2B (MZT2B). [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
5 Influence of cell cycle on responses of MCF-7 cells to benzo[a]pyrene. BMC Genomics. 2011 Jun 29;12:333.
6 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
7 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.