General Information of Drug Off-Target (DOT) (ID: OT91HOEP)

DOT Name Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 (NKAIN4)
Synonyms Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 4; Protein FAM77A
Gene Name NKAIN4
Related Disease
Cardiovascular disease ( )
UniProt ID
NKAI4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF05640
Sequence
MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILGLFGTIQYRLR
YVMVYTLWAAVWVTWNVFIICFYLEVGGLLKDSELLTFSLSRHRSWWRERWPGCLHEEVP
AVGLGAPHGQALVSGAGCALEPSYVEALHSCLQILIALLGFVCGCQVVSVFTEEEDSFDF
IGGFDPFPLYHVNEKPSSLLSKQVYLPA

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cardiovascular disease DIS2IQDX Strong Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 (NKAIN4). [2]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 (NKAIN4). [3]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 (NKAIN4). [4]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 (NKAIN4). [6]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 (NKAIN4). [7]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 (NKAIN4). [5]
------------------------------------------------------------------------------------

References

1 Genetic determinants of cardiovascular events among women with migraine: a genome-wide association study.PLoS One. 2011;6(7):e22106. doi: 10.1371/journal.pone.0022106. Epub 2011 Jul 14.
2 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
3 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
4 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
5 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
6 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
7 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.