Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9JJQQQ)

• DOT Name: Resistin-like beta (RETNLB)
• Synonyms: Colon and small intestine-specific cysteine-rich protein; Colon carcinoma-related gene protein; Cysteine-rich secreted protein A12-alpha-like 1; Cysteine-rich secreted protein FIZZ2; RELMbeta
• Gene Name: RETNLB
• Related Disease:
  Colonic neoplasm
  Arteriosclerosis
  Atherosclerosis
  Colitis
  High blood pressure
  Nematode infection
  Neoplasm
  Pneumonia
  Pneumonitis
  Pulmonary disease
  Pulmonary fibrosis
  Asthma
  Gastroparesis
• UniProt ID: RETNB_HUMAN
• Pfam ID: PF06954
• Sequence:
  MGPSSCLLLILIPLLQLINPGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKS
  QGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
• Function: Probable hormone.
• Tissue Specificity: Expressed only in the gastrointestinal tract, particularly the colon.

Molecular Interaction Atlas (MIA) of This DOT

13 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colonic neoplasm	DISSZ04P	Definitive	Biomarker	[1]
Arteriosclerosis	DISK5QGC	Strong	Altered Expression	[2]
Atherosclerosis	DISMN9J3	Strong	Altered Expression	[2]
Colitis	DISAF7DD	Strong	Altered Expression	[3]
High blood pressure	DISY2OHH	Strong	Biomarker	[4]
Nematode infection	DISVFLRK	Strong	Altered Expression	[5]
Neoplasm	DISZKGEW	Strong	Altered Expression	[6]
Pneumonia	DIS8EF3M	Strong	Biomarker	[7]
Pneumonitis	DIS88E0K	Strong	Biomarker	[7]
Pulmonary disease	DIS6060I	Strong	Biomarker	[8]
Pulmonary fibrosis	DISQKVLA	Strong	Biomarker	[8]
Asthma	DISW9QNS	moderate	Biomarker	[9]
Gastroparesis	DISDW0SR	Disputed	Altered Expression	[10]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Resistin-like beta (RETNLB).	[11]
CYCLOPAMINE	DMEM2SW	Investigative	CYCLOPAMINE increases the expression of Resistin-like beta (RETNLB).	[13]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Resistin-like beta (RETNLB).	[12]

References

• [1] Enhanced expression of resistin-like molecule beta in human colon cancer and its clinical significance.Dig Dis Sci. 2009 Feb;54(2):274-81. doi: 10.1007/s10620-008-0355-2. Epub 2008 Jul 2.
• [2] Resistin-like molecule is abundantly expressed in foam cells and is involved in atherosclerosis development.Arterioscler Thromb Vasc Biol. 2013 Aug;33(8):1986-93. doi: 10.1161/ATVBAHA.113.301546. Epub 2013 May 23.
• [3] Dual roles of IL-18 in colitis through regulation of the function and quantity of goblet cells.Int J Mol Med. 2019 Jun;43(6):2291-2302. doi: 10.3892/ijmm.2019.4156. Epub 2019 Apr 4.
• [4] Hypoxia-Induced Mitogenic Factor Promotes Cardiac Hypertrophy via Calcium-Dependent and Hypoxia-Inducible Factor-1 Mechanisms.Hypertension. 2018 Aug;72(2):331-342. doi: 10.1161/HYPERTENSIONAHA.118.10845. Epub 2018 Jun 11.
• [5] A Novel Non-invasive Method to Detect RELM Beta Transcript in Gut Barrier Related Changes During a Gastrointestinal Nematode Infection.Front Immunol. 2019 Mar 12;10:445. doi: 10.3389/fimmu.2019.00445. eCollection 2019.
• [6] A single neonatal administration of Bisphenol A induces higher tumour weight associated to changes in tumour microenvironment in the adulthood.Sci Rep. 2017 Sep 5;7(1):10573. doi: 10.1038/s41598-017-10135-1.
• [7] FIZZ1, a novel cysteine-rich secreted protein associated with pulmonary inflammation, defines a new gene family.EMBO J. 2000 Aug 1;19(15):4046-55. doi: 10.1093/emboj/19.15.4046.
• [8] FIZZ2/RELM- induction and role in pulmonary fibrosis.J Immunol. 2011 Jul 1;187(1):450-61. doi: 10.4049/jimmunol.1000964. Epub 2011 May 20.
• [9] Resistin-like molecule- (RELM-) targets airways fibroblasts to effect remodelling in asthma: from mouse to man.Clin Exp Allergy. 2015 May;45(5):940-952. doi: 10.1111/cea.12481.
• [10] Change in Populations of Macrophages Promotes Development of Delayed Gastric Emptying in Mice.Gastroenterology. 2018 Jun;154(8):2122-2136.e12. doi: 10.1053/j.gastro.2018.02.027. Epub 2018 Mar 6.
• [11] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [12] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [13] M2 macrophage-derived IL6 mediates resistance of breast cancer cells to hedgehog inhibition. Toxicol Appl Pharmacol. 2019 Feb 1;364:77-82. doi: 10.1016/j.taap.2018.12.013. Epub 2018 Dec 19.