Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBIYMJ0)

DOT Name Ribonucleases P/MRP protein subunit POP1 (POP1)
Synonyms hPOP1
Gene Name POP1
Related Disease
Osteochondrodysplasia ( )
Skeletal dysplasia ( )
Advanced cancer ( )
Anauxetic dysplasia 2 ( )
Visceral leishmaniasis ( )
Connective tissue disorder ( )
Anauxetic dysplasia ( )
Inflammation ( )
UniProt ID
POP1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
6AHR; 6AHU
Pfam ID
PF06978 ; PF08170
Sequence
MSNAKERKHAKKMRNQPTNVTLSSGFVADRGVKHHSGGEKPFQAQKQEPHPGTSRQRQTR
VNPHSLPDPEVNEQSSSKGMFRKKGGWKAGPEGTSQEIPKYITASTFAQARAAEISAMLK
AVTQKSSNSLVFQTLPRHMRRRAMSHNVKRLPRRLQEIAQKEAEKAVHQKKEHSKNKCHK
ARRCHMNRTLEFNRRQKKNIWLETHIWHAKRFHMVKKWGYCLGERPTVKSHRACYRAMTN
RCLLQDLSYYCCLELKGKEEEILKALSGMCNIDTGLTFAAVHCLSGKRQGSLVLYRVNKY
PREMLGPVTFIWKSQRTPGDPSESRQLWIWLHPTLKQDILEEIKAACQCVEPIKSAVCIA
DPLPTPSQEKSQTELPDEKIGKKRKRKDDGENAKPIKKIIGDGTRDPCLPYSWISPTTGI
IISDLTMEMNRFRLIGPLSHSILTEAIKAASVHTVGEDTEETPHRWWIETCKKPDSVSLH
CRQEAIFELLGGITSPAEIPAGTILGLTVGDPRINLPQKKSKALPNPEKCQDNEKVRQLL
LEGVPVECTHSFIWNQDICKSVTENKISDQDLNRMRSELLVPGSQLILGPHESKIPILLI
QQPGKVTGEDRLGWGSGWDVLLPKGWGMAFWIPFIYRGVRVGGLKESAVHSQYKRSPNVP
GDFPDCPAGMLFAEEQAKNLLEKYKRRPPAKRPNYVKLGTLAPFCCPWEQLTQDWESRVQ
AYEEPSVASSPNGKESDLRRSEVPCAPMPKKTHQPSDEVGTSIEHPREAEEVMDAGCQES
AGPERITDQEASENHVAATGSHLCVLRSRKLLKQLSAWCGPSSEDSRGGRRAPGRGQQGL
TREACLSILGHFPRALVWVSLSLLSKGSPEPHTMICVPAKEDFLQLHEDWHYCGPQESKH
SDPFRSKILKQKEKKKREKRQKPGRASSDGPAGEEPVAGQEALTLGLWSGPLPRVTLHCS
RTLLGFVTQGDFSMAVGCGEALGFVSLTGLLDMLSSQPAAQRGLVLLRPPASLQYRFARI
AIEV
Function
Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences.
KEGG Pathway
Ribosome biogenesis in eukaryotes (hsa03008 )
Reactome Pathway
tRNA processing in the nucleus (R-HSA-6784531 )

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Osteochondrodysplasia DIS9SPWW Definitive Genetic Variation [1]
Skeletal dysplasia DIS5Z8U6 Definitive Genetic Variation [1]
Advanced cancer DISAT1Z9 Strong Biomarker [2]
Anauxetic dysplasia 2 DIS071X0 Strong Autosomal recessive [3]
Visceral leishmaniasis DISTKEYK Strong Genetic Variation [4]
Connective tissue disorder DISKXBS3 moderate Biomarker [5]
Anauxetic dysplasia DISFIUUO Supportive Autosomal recessive [3]
Inflammation DISJUQ5T Limited Biomarker [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Ribonucleases P/MRP protein subunit POP1 (POP1). [7]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Ribonucleases P/MRP protein subunit POP1 (POP1). [17]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Ribonucleases P/MRP protein subunit POP1 (POP1). [18]
Coumarin DM0N8ZM Investigative Coumarin increases the phosphorylation of Ribonucleases P/MRP protein subunit POP1 (POP1). [18]
------------------------------------------------------------------------------------
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Ribonucleases P/MRP protein subunit POP1 (POP1). [8]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Ribonucleases P/MRP protein subunit POP1 (POP1). [9]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Ribonucleases P/MRP protein subunit POP1 (POP1). [10]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Ribonucleases P/MRP protein subunit POP1 (POP1). [11]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Ribonucleases P/MRP protein subunit POP1 (POP1). [12]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Ribonucleases P/MRP protein subunit POP1 (POP1). [13]
Marinol DM70IK5 Approved Marinol decreases the expression of Ribonucleases P/MRP protein subunit POP1 (POP1). [14]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Ribonucleases P/MRP protein subunit POP1 (POP1). [15]
GSK2110183 DMZHB37 Phase 2 GSK2110183 decreases the expression of Ribonucleases P/MRP protein subunit POP1 (POP1). [16]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN decreases the expression of Ribonucleases P/MRP protein subunit POP1 (POP1). [19]
GALLICACID DM6Y3A0 Investigative GALLICACID increases the expression of Ribonucleases P/MRP protein subunit POP1 (POP1). [20]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)

References

1 Broadening the phenotypic spectrum of POP1-skeletal dysplasias: identification of POP1 mutations in a mild and severe skeletal dysplasia.Clin Genet. 2017 Jul;92(1):91-98. doi: 10.1111/cge.12964. Epub 2017 Feb 22.
2 Rectus Sheath Block (RSB) Analgesia Could Enhance Significantly the Patient Satisfaction Following Midline Laparotomy in Benign Disease and in Cancer: A Prospective Study With Special Reference to Nitrosative Stress Marker Nitrotyrosine (NT) Plasma Concentrations.Anticancer Res. 2019 Mar;39(3):1383-1389. doi: 10.21873/anticanres.13252.
3 Whole-exome re-sequencing in a family quartet identifies POP1 mutations as the cause of a novel skeletal dysplasia. PLoS Genet. 2011 Mar;7(3):e1002027. doi: 10.1371/journal.pgen.1002027. Epub 2011 Mar 24.
4 The genetic structure of Leishmania infantum populations in Brazil and its possible association with the transmission cycle of visceral leishmaniasis.PLoS One. 2012;7(5):e36242. doi: 10.1371/journal.pone.0036242. Epub 2012 May 11.
5 hPop1: an autoantigenic protein subunit shared by the human RNase P and RNase MRP ribonucleoproteins.EMBO J. 1996 Nov 1;15(21):5936-48.
6 The PYRIN Domain-only Protein POP1 Inhibits Inflammasome Assembly and Ameliorates Inflammatory Disease.Immunity. 2015 Aug 18;43(2):264-76. doi: 10.1016/j.immuni.2015.07.018. Epub 2015 Aug 11.
7 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
8 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
9 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
10 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
11 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
12 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
13 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
14 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
15 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
16 Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
17 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
18 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
19 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
20 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.