Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBXHP9U)

DOT Name	tRNA-dihydrouridine(20a/20b) synthase -like (DUS4L)
Synonyms	EC 1.3.1.90; pp35; tRNA-dihydrouridine synthase 4-like
Gene Name	DUS4L
Related Disease	Osteoarthritis ( )
UniProt ID	DUS4L_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	1.3.1.90
Pfam ID	PF01207
Sequence	MKSDCMQTTICQERKKDPIEMFHSGQLVKVCAPMVRYSKLAFRTLVRKYSCDLCYTPMIV AADFVKSIKARDSEFTTNQGDCPLIVQFAANDARLLSDAARIVCPYANGIDINCGCPQRW AMAEGYGACLINKPELVQDMVKQVRNQVETPGFSVSIKIRIHDDLKRTVDLCQKAEATGV SWITVHGRTAEERHQPVHYDSIKIIKENMSIPVIANGDIRSLKEAENVWRITGTDGVMVA RGLLANPAMFAGYEETPLKCIWDWVDIALELGTPYMCFHQHLMYMMEKITSRQEKRVFNA LSSTSAIIDYLTDHYGI
Function	Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Osteoarthritis	DIS05URM	moderate	Altered Expression	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of tRNA-dihydrouridine(20a/20b) synthase -like (DUS4L).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of tRNA-dihydrouridine(20a/20b) synthase -like (DUS4L).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of tRNA-dihydrouridine(20a/20b) synthase -like (DUS4L).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of tRNA-dihydrouridine(20a/20b) synthase -like (DUS4L).	[5]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of tRNA-dihydrouridine(20a/20b) synthase -like (DUS4L).	[6]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of tRNA-dihydrouridine(20a/20b) synthase -like (DUS4L).	[7]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of tRNA-dihydrouridine(20a/20b) synthase -like (DUS4L).	[8]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Drug(s)

References

1	Gene expression analysis reveals HBP1 as a key target for the osteoarthritis susceptibility locus that maps to chromosome 7q22.Ann Rheum Dis. 2012 Dec;71(12):2020-7. doi: 10.1136/annrheumdis-2012-201304. Epub 2012 May 14.
2	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
3	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
7	Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
8	Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.