Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC55IN4)

• DOT Name: Zinc transporter 7 (SLC30A7)
• Synonyms: ZnT-7; Solute carrier family 30 member 7; Znt-like transporter 2
• Gene Name: SLC30A7
• UniProt ID: ZNT7_HUMAN
• PDB ID: 8J7T; 8J7U; 8J7V; 8J7W; 8J7X; 8J7Y; 8J80
• Pfam ID: PF01545
• Sequence:
  MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSN
  CLGLISDSFHMFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAF
  FIFSEGVERALAPPDVHHERLLLVSILGFVVNLIGIFVFKHGGHGHSHGSGHGHSHSLFN
  GALDQAHGHVDHCHSHEVKHGAAHSHDHAHGHGHFHSHDGPSLKETTGPSRQILQGVFLH
  ILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVVSVIPLLRESVGILMQRTPPL
  LENSLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARWILSQTHNIFT
  QAGVRQLYVQIDFAAM
• Function: Zinc ion transporter mediating zinc entry from the cytosol into the lumen of organelles along the secretory pathway. By contributing to zinc ion homeostasis within the early secretory pathway, regulates the activation and folding of enzymes like alkaline phosphatases.

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Zinc transporter 7 (SLC30A7).	[1]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Zinc transporter 7 (SLC30A7).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Zinc transporter 7 (SLC30A7).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Zinc transporter 7 (SLC30A7).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Zinc transporter 7 (SLC30A7).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Zinc transporter 7 (SLC30A7).	[6]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Zinc transporter 7 (SLC30A7).	[7]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Zinc transporter 7 (SLC30A7).	[8]
Zidovudine	DM4KI7O	Approved	Zidovudine increases the expression of Zinc transporter 7 (SLC30A7).	[9]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Zinc transporter 7 (SLC30A7).	[10]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Zinc transporter 7 (SLC30A7).	[11]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Zinc transporter 7 (SLC30A7).	[12]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of Zinc transporter 7 (SLC30A7).	[13]
Forskolin	DM6ITNG	Investigative	Forskolin decreases the expression of Zinc transporter 7 (SLC30A7).	[13]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [6] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [7] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [8] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [9] Differential gene expression in human hepatocyte cell lines exposed to the antiretroviral agent zidovudine. Arch Toxicol. 2014 Mar;88(3):609-23. doi: 10.1007/s00204-013-1169-3. Epub 2013 Nov 30.
• [10] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [11] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [12] Intracellular zinc stores protect the intestinal epithelium from Ochratoxin A toxicity. Toxicol In Vitro. 2009 Dec;23(8):1516-21.
• [13] Identification of genes targeted by the androgen and PKA signaling pathways in prostate cancer cells. Oncogene. 2006 Nov 23;25(55):7311-23.