Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCFGFJH)

• DOT Name: TraB domain-containing protein (TRABD)
• Synonyms: Protein TTG2
• Gene Name: TRABD
• Related Disease:
  Neoplasm
  Acute lymphocytic leukaemia
  Coeliac disease
  Insulinoma
  Leukemia
  Tendinopathy
• UniProt ID: TRABD_HUMAN
• Pfam ID: PF01963
• Sequence:
  MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMKLKRRRQRPNL
  PRTVTQLVAEDGSRVYVVGTAHFSDDSKRDVVKTIREVQPDVVVVELCQYRVSMLKMDES
  TLLREAQELSLEKLQQAVRQNGLMSGLMQMLLLKVSAHITEQLGMAPGGEFREAFKEASK
  VPFCKFHLGDRPIPVTFKRAIAALSFWQKVRLAWGLCFLSDPISKDDVERCKQKDLLEQM
  MAEMIGEFPDLHRTIVSERDVYLTYMLRQAARRLELPRASDAEPRKCVPSVVVGVVGMGH
  VPGIEKNWSTDLNIQEIMTVPPPSVSGRVSRLAVKAAFFGLLGYSLYWMGRRTASLVLSL
  PAAQYCLQRVTEARHK

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Definitive	Biomarker	[1]
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[2]
Coeliac disease	DISIY60C	Strong	Biomarker	[3]
Insulinoma	DISIU1JS	Strong	Altered Expression	[4]
Leukemia	DISNAKFL	Strong	Genetic Variation	[5]
Tendinopathy	DISJH7UX	Strong	Altered Expression	[6]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of TraB domain-containing protein (TRABD).	[7]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the methylation of TraB domain-containing protein (TRABD).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of TraB domain-containing protein (TRABD).	[9]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of TraB domain-containing protein (TRABD).	[10]

References

• [1] Integrative identification of Epstein-Barr virus-associated mutations and epigenetic alterations in gastric cancer.Gastroenterology. 2014 Dec;147(6):1350-62.e4. doi: 10.1053/j.gastro.2014.08.036. Epub 2014 Aug 28.
• [2] LIM domain proteins in leukaemia and development.Semin Cancer Biol. 1993 Dec;4(6):349-58.
• [3] Case-finding in primary care for coeliac disease: Accuracy and cost-effectiveness of a rapid point-of-care test.United European Gastroenterol J. 2018 Jul;6(6):855-865. doi: 10.1177/2050640618761700. Epub 2018 Feb 20.
• [4] Modifying Enzymes Are Elicited by ER Stress, Generating Epitopes That Are Selectively Recognized by CD4(+) T Cells in Patients With Type 1 Diabetes.Diabetes. 2018 Jul;67(7):1356-1368. doi: 10.2337/db17-1166. Epub 2018 Apr 13.
• [5] TTG-2, a new gene encoding a cysteine-rich protein with the LIM motif, is overexpressed in acute T-cell leukaemia with the t(11;14)(p13;q11).Oncogene. 1991 Oct;6(10):1887-93.
• [6] Gene expression analysis in calcific tendinopathy of the rotator cuff.Eur Cell Mater. 2011 Jun 20;21:548-57. doi: 10.22203/ecm.v021a41.
• [7] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [8] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [9] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [10] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.