Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCJG5WM)

• DOT Name: Coronin-2B (CORO2B)
• Synonyms: Coronin-like protein C; Clipin-C; Protein FC96
• Gene Name: CORO2B
• Related Disease:
  Diabetic kidney disease
  Nephropathy
  Type-1/2 diabetes
• UniProt ID: COR2B_HUMAN
• Pfam ID: PF08953 ; PF00400 ; PF16300
• Sequence:
  MTVTKMSWRPQYRSSKFRNVYGKVANREHCFDGIPITKNVHDNHFCAVNTRFLAIVTESA
  GGGSFLVIPLEQTGRIEPNYPKVCGHQGNVLDIKWNPFIDNIIASCSEDTSVRIWEIPEG
  GLKRNMTEALLELHGHSRRVGLVEWHPTTNNILFSAGYDYKVLIWNLDVGEPVKMIDCHT
  DVILCMSFNTDGSLLTTTCKDKKLRVIEPRSGRVLQEANCKNHRVNRVVFLGNMKRLLTT
  GVSRWNTRQIALWDQEDLSMPLIEEEIDGLSGLLFPFYDADTHMLYLAGKGDGNIRYYEI
  STEKPYLSYLMEFRSPAPQKGLGVMPKHGLDVSACEVFRFYKLVTLKGLIEPISMIVPRR
  SDSYQEDIYPMTPGTEPALTPDEWLGGINRDPVLMSLKEGYKKSSKMVFKAPIKEKKSVV
  VNGIDLLENVPPRTENELLRMFFRQQDEIRRLKEELAQKDIRIRQLQLELKNLRNSPKNC
• Function: May play a role in the reorganization of neuronal actin structure.
• Tissue Specificity: Expressed predominantly in brain.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Diabetic kidney disease	DISJMWEY	Definitive	Altered Expression	[1]
Nephropathy	DISXWP4P	Definitive	Altered Expression	[1]
Type-1/2 diabetes	DISIUHAP	Definitive	Altered Expression	[1]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Coronin-2B (CORO2B).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Coronin-2B (CORO2B).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Coronin-2B (CORO2B).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Coronin-2B (CORO2B).	[5]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Coronin-2B (CORO2B).	[3]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Coronin-2B (CORO2B).	[6]
Marinol	DM70IK5	Approved	Marinol increases the expression of Coronin-2B (CORO2B).	[7]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Coronin-2B (CORO2B).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Coronin-2B (CORO2B).	[9]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Coronin-2B (CORO2B).	[10]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid increases the expression of Coronin-2B (CORO2B).	[12]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Coronin-2B (CORO2B).	[11]

References

• [1] Coro2b, a podocyte protein downregulated in human diabetic nephropathy, is involved in the development of protamine sulphate-induced foot process effacement.Sci Rep. 2019 Jun 20;9(1):8888. doi: 10.1038/s41598-019-45303-y.
• [2] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [3] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [4] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [6] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [7] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [8] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [9] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [10] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [11] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [12] Roles of acyl-CoA synthetase long-chain family member 5 and colony stimulating factor 2 in inhibition of palmitic or stearic acids in lung cancer cell proliferation and metabolism. Cell Biol Toxicol. 2021 Feb;37(1):15-34. doi: 10.1007/s10565-020-09520-w. Epub 2020 Apr 28.