Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTD1P6LA)

DOT Name F-box only protein 30 (FBXO30)
Gene Name FBXO30
UniProt ID
FBX30_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2YRE
Pfam ID
PF15966 ; PF15965
Sequence
MEEELQHSHCVNCVSRRCMTRPEPGISCDLIGCPLVCGAVFHSCKADEHRLLCPFERVPC
LNSDFGCPFTMARNKVAEHLEMCPASVVCCTMEWNRWPVSYADRKSYENLSRDVDEVAQL
DMALALQDQRMLLESLKVATMMSKATDKVSKPREQISVKSSVPEIPHANGLVSVDEESYG
ALYQATVETTRSLAAALDILNTATRDIGMLNTSVPNDMDEQQNARESLEDQNLKDQDHLY
EEEIGAVGGIDYNDTNQNAQSEQNGSSDLLCDLNTSSYDTSALCNGFPLENICTQVIDQN
QNLHGDSKQSNLTNGDCVASSDGTSKPSSSLAVAAQLREIIPSSALPNGTVQHILMPDDE
GEGELCWKKVDLGDVKNVDVLSFSHAPSFNFLSNSCWSKPKEDKAVDTSDLEVAEDPMGL
QGIDLITAALLFCLGDSPGGRGISDSRMADIYHIDVGTQTFSLPSAILATSTMVGEIASA
SACDHANPQLSNPSPFQTLGLDLVLECVARYQPKQRSMFTFVCGQLFRRKEFSSHFKNVH
GDIHAGLNGWMEQRCPLAYYGCTYSQRRFCPSIQGAKIIHDRHLRSFGVQPCVSTVLVEP
ARNCVLGLHNDHLSSLPFEVLQHIAGFLDGFSLCQLSCVSKLMRDVCGSLLQSRGMVILQ
WGKRKYPEGNSSWQIKEKVWRFSTAFCSVNEWKFADILSMADHLKKCSYNVVEKREEAIP
LPCMCVTRELTKEGRSLRSVLKPVL
Function Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Required for muscle atrophy following denervation.
Reactome Pathway
Antigen processing (R-HSA-983168 )
Neddylation (R-HSA-8951664 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
23 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of F-box only protein 30 (FBXO30). [1]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of F-box only protein 30 (FBXO30). [2]
Acetaminophen DMUIE76 Approved Acetaminophen affects the expression of F-box only protein 30 (FBXO30). [3]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of F-box only protein 30 (FBXO30). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of F-box only protein 30 (FBXO30). [5]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of F-box only protein 30 (FBXO30). [6]
Estradiol DMUNTE3 Approved Estradiol increases the expression of F-box only protein 30 (FBXO30). [7]
Quercetin DM3NC4M Approved Quercetin decreases the expression of F-box only protein 30 (FBXO30). [8]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of F-box only protein 30 (FBXO30). [9]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of F-box only protein 30 (FBXO30). [10]
Marinol DM70IK5 Approved Marinol increases the expression of F-box only protein 30 (FBXO30). [11]
Menadione DMSJDTY Approved Menadione increases the expression of F-box only protein 30 (FBXO30). [12]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol increases the expression of F-box only protein 30 (FBXO30). [13]
Azathioprine DMMZSXQ Approved Azathioprine increases the expression of F-box only protein 30 (FBXO30). [13]
Cidofovir DMA13GD Approved Cidofovir decreases the expression of F-box only protein 30 (FBXO30). [6]
Ifosfamide DMCT3I8 Approved Ifosfamide decreases the expression of F-box only protein 30 (FBXO30). [6]
Clodronate DM9Y6X7 Approved Clodronate decreases the expression of F-box only protein 30 (FBXO30). [6]
Chlorambucil DMRKE63 Approved Chlorambucil decreases the expression of F-box only protein 30 (FBXO30). [13]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of F-box only protein 30 (FBXO30). [14]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of F-box only protein 30 (FBXO30). [16]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of F-box only protein 30 (FBXO30). [17]
Resorcinol DMM37C0 Investigative Resorcinol increases the expression of F-box only protein 30 (FBXO30). [13]
CH-223191 DMMJZYC Investigative CH-223191 decreases the expression of F-box only protein 30 (FBXO30). [18]
------------------------------------------------------------------------------------
⏷ Show the Full List of 23 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of F-box only protein 30 (FBXO30). [15]
------------------------------------------------------------------------------------

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
7 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
8 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
9 Gene expression profile induced by arsenic trioxide in chronic lymphocytic leukemia cells reveals a central role for heme oxygenase-1 in apoptosis and regulation of matrix metalloproteinase-9. Oncotarget. 2016 Dec 13;7(50):83359-83377.
10 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
11 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
12 Time series analysis of oxidative stress response patterns in HepG2: a toxicogenomics approach. Toxicology. 2013 Apr 5;306:24-34.
13 Oxidative stress mechanisms do not discriminate between genotoxic and nongenotoxic liver carcinogens. Chem Res Toxicol. 2015 Aug 17;28(8):1636-46.
14 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
15 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
16 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
17 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
18 Adaptive changes in global gene expression profile of lung carcinoma A549 cells acutely exposed to distinct types of AhR ligands. Toxicol Lett. 2018 Aug;292:162-174.