General Information of Drug Off-Target (DOT) (ID: OTDG5VW7)

DOT Name Succinate dehydrogenase assembly factor 1, mitochondrial (SDHAF1)
Synonyms SDH assembly factor 1; SDHAF1; LYR motif-containing protein 8
Gene Name SDHAF1
Related Disease
Cardiomyopathy ( )
Mitochondrial complex II deficiency, nuclear type 1 ( )
Mitochondrial disease ( )
Obsolete mitochondrial complex II deficiency ( )
Vascular dementia ( )
Dystonia ( )
Leigh syndrome ( )
UniProt ID
SDHF1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF05347
Sequence
MSRHSRLQRQVLSLYRDLLRAGRGKPGAEARVRAEFRQHAGLPRSDVLRIEYLYRRGRRQ
LQLLRSGHATAMGAFVRPRAPTGEPGGVGCQPDDGDSPRNPHDSTGAPETRPDGR
Function
Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Promotes maturation of the iron-sulfur protein subunit SDHB of the SDH catalytic dimer, protecting it from the deleterious effects of oxidants. May act together with SDHAF3. Contributes to iron-sulfur cluster incorporation into SDHB by binding to SDHB and recruiting the iron-sulfur transfer complex formed by HSC20, HSPA9 and ISCU through direct binding to HSC20.
Tissue Specificity Ubiquitously expressed.

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cardiomyopathy DISUPZRG Definitive Genetic Variation [1]
Mitochondrial complex II deficiency, nuclear type 1 DISJ424P Definitive Autosomal recessive [2]
Mitochondrial disease DISKAHA3 Definitive Autosomal recessive [3]
Obsolete mitochondrial complex II deficiency DIS67XU0 Moderate Autosomal recessive [4]
Vascular dementia DISVO82H Disputed Biomarker [5]
Dystonia DISJLFGW Limited Biomarker [6]
Leigh syndrome DISWQU45 Limited Autosomal recessive [3]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Succinate dehydrogenase assembly factor 1, mitochondrial (SDHAF1). [7]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Succinate dehydrogenase assembly factor 1, mitochondrial (SDHAF1). [8]
Etoposide DMNH3PG Approved Etoposide decreases the expression of Succinate dehydrogenase assembly factor 1, mitochondrial (SDHAF1). [8]
Mitomycin DMH0ZJE Approved Mitomycin decreases the expression of Succinate dehydrogenase assembly factor 1, mitochondrial (SDHAF1). [8]
Colchicine DM2POTE Approved Colchicine decreases the expression of Succinate dehydrogenase assembly factor 1, mitochondrial (SDHAF1). [8]
Adenine DMZLHKJ Approved Adenine decreases the expression of Succinate dehydrogenase assembly factor 1, mitochondrial (SDHAF1). [8]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Succinate dehydrogenase assembly factor 1, mitochondrial (SDHAF1). [9]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Succinate dehydrogenase assembly factor 1, mitochondrial (SDHAF1). [11]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Succinate dehydrogenase assembly factor 1, mitochondrial (SDHAF1). [12]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Succinate dehydrogenase assembly factor 1, mitochondrial (SDHAF1). [13]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate increases the expression of Succinate dehydrogenase assembly factor 1, mitochondrial (SDHAF1). [14]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Succinate dehydrogenase assembly factor 1, mitochondrial (SDHAF1). [10]
------------------------------------------------------------------------------------

References

1 Recessive germline SDHA and SDHB mutations causing leukodystrophy and isolated mitochondrial complex II deficiency. J Med Genet. 2012 Sep;49(9):569-77. doi: 10.1136/jmedgenet-2012-101146.
2 Flexible and scalable diagnostic filtering of genomic variants using G2P with Ensembl VEP. Nat Commun. 2019 May 30;10(1):2373. doi: 10.1038/s41467-019-10016-3.
3 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
4 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
5 SDHAF1, encoding a LYR complex-II specific assembly factor, is mutated in SDH-defective infantile leukoencephalopathy. Nat Genet. 2009 Jun;41(6):654-6. doi: 10.1038/ng.378. Epub 2009 May 24.
6 Complex II deficiency--a case report and review of the literature.Am J Med Genet A. 2013 Feb;161A(2):285-94. doi: 10.1002/ajmg.a.35714. Epub 2013 Jan 15.
7 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
8 Utilization of CDKN1A/p21 gene for class discrimination of DNA damage-induced clastogenicity. Toxicology. 2014 Jan 6;315:8-16. doi: 10.1016/j.tox.2013.10.009. Epub 2013 Nov 6.
9 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
12 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
13 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
14 Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.