Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDM1DWJ)

DOT Name	Dynein light chain Tctex-type 5 (DYNLT5)
Synonyms	Tctex1 domain-containing protein 1
Gene Name	DYNLT5
UniProt ID	DYLT5_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF03645
Sequence	MMMSDNAKGRAAHSWKKRGSISSLSNHEFWRKEIHGRIKDSMSTVSYMEEPSQRDDISRL TVQMENTYQLGPPKHFPVVTVNHILKDVVTSYLQVEEYEPELCRQMTKTISEVIKAQVKD LMIPRYKLIVIVHIGQLNRQSILIGSRCLWDPKSDTFSSYVFRNSSLFALANVYAVYLE
KEGG Pathway	Motor proteins (hsa04814 )
Reactome Pathway	Intraflagellar transport (R-HSA-5620924 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Dynein light chain Tctex-type 5 (DYNLT5).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Dynein light chain Tctex-type 5 (DYNLT5).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Dynein light chain Tctex-type 5 (DYNLT5).	[3]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Dynein light chain Tctex-type 5 (DYNLT5).	[4]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Dynein light chain Tctex-type 5 (DYNLT5).	[3]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of Dynein light chain Tctex-type 5 (DYNLT5).	[5]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Drug(s)

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Dynein light chain Tctex-type 5 (DYNLT5).	[6]
------------------------------------------------------------------------------------

References

1	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
2	Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
3	Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
4	Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
5	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
6	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.