General Information of Drug Off-Target (DOT) (ID: OTDOTWU4)

DOT Name Ribosomal protein S6 kinase alpha-1 (RPS6KA1)
Synonyms
S6K-alpha-1; EC 2.7.11.1; 90 kDa ribosomal protein S6 kinase 1; p90-RSK 1; p90RSK1; p90S6K; MAP kinase-activated protein kinase 1a; MAPK-activated protein kinase 1a; MAPKAP kinase 1a; MAPKAPK-1a; Ribosomal S6 kinase 1; RSK-1
Gene Name RPS6KA1
UniProt ID
KS6A1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2WNT; 2Z7Q; 2Z7R; 2Z7S; 3RNY; 3TEI; 4H3P; 4NIF; 5CSF; 5CSI; 5CSJ; 5CSN; 5N7D; 5N7F; 5N7G; 5V61; 5V62; 6TWY; 7P74; 7PC8; 7QQL; 8WF4
EC Number
2.7.11.1
Pfam ID
PF00069 ; PF00433
Sequence
MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPS
HFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVN
HPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHS
LGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHS
HSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRN
PANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYFDTEFTSRTP
KDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSDGYVV
KETIGVGSYSECKRCVHKATNMEYAVKVIDKSKRDPSEEIEILLRYGQHPNIITLKDVYD
DGKHVYLVTELMRGGELLDKILRQKFFSEREASFVLHTIGKTVEYLHSQGVVHRDLKPSN
ILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSL
GILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDP
HQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESS
ILAQRRVRKLPSTTL
Function
Serine/threonine-protein kinase that acts downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and mediates mitogenic and stress-induced activation of the transcription factors CREB1, ETV1/ER81 and NR4A1/NUR77, regulates translation through RPS6 and EIF4B phosphorylation, and mediates cellular proliferation, survival, and differentiation by modulating mTOR signaling and repressing pro-apoptotic function of BAD and DAPK1. In fibroblast, is required for EGF-stimulated phosphorylation of CREB1, which results in the subsequent transcriptional activation of several immediate-early genes. In response to mitogenic stimulation (EGF and PMA), phosphorylates and activates NR4A1/NUR77 and ETV1/ER81 transcription factors and the cofactor CREBBP. Upon insulin-derived signal, acts indirectly on the transcription regulation of several genes by phosphorylating GSK3B at 'Ser-9' and inhibiting its activity. Phosphorylates RPS6 in response to serum or EGF via an mTOR-independent mechanism and promotes translation initiation by facilitating assembly of the pre-initiation complex. In response to insulin, phosphorylates EIF4B, enhancing EIF4B affinity for the EIF3 complex and stimulating cap-dependent translation. Is involved in the mTOR nutrient-sensing pathway by directly phosphorylating TSC2 at 'Ser-1798', which potently inhibits TSC2 ability to suppress mTOR signaling, and mediates phosphorylation of RPTOR, which regulates mTORC1 activity and may promote rapamycin-sensitive signaling independently of the PI3K/AKT pathway. Also involved in feedback regulation of mTORC1 and mTORC2 by phosphorylating DEPTOR. Mediates cell survival by phosphorylating the pro-apoptotic proteins BAD and DAPK1 and suppressing their pro-apoptotic function. Promotes the survival of hepatic stellate cells by phosphorylating CEBPB in response to the hepatotoxin carbon tetrachloride (CCl4). Mediates induction of hepatocyte prolifration by TGFA through phosphorylation of CEBPB. Is involved in cell cycle regulation by phosphorylating the CDK inhibitor CDKN1B, which promotes CDKN1B association with 14-3-3 proteins and prevents its translocation to the nucleus and inhibition of G1 progression. Phosphorylates EPHA2 at 'Ser-897', the RPS6KA-EPHA2 signaling pathway controls cell migration. In response to mTORC1 activation, phosphorylates EIF4B at 'Ser-406' and 'Ser-422' which stimulates bicarbonate cotransporter SLC4A7 mRNA translation, increasing SLC4A7 protein abundance and function ; (Microbial infection) Promotes the late transcription and translation of viral lytic genes during Kaposi's sarcoma-associated herpesvirus/HHV-8 infection, when constitutively activated.
KEGG Pathway
MAPK sig.ling pathway (hsa04010 )
Oocyte meiosis (hsa04114 )
mTOR sig.ling pathway (hsa04150 )
Thermogenesis (hsa04714 )
Long-term potentiation (hsa04720 )
Neurotrophin sig.ling pathway (hsa04722 )
Progesterone-mediated oocyte maturation (hsa04914 )
Insulin resistance (hsa04931 )
Yersinia infection (hsa05135 )
Chemical carcinogenesis - receptor activation (hsa05207 )
Reactome Pathway
CREB phosphorylation (R-HSA-199920 )
Senescence-Associated Secretory Phenotype (SASP) (R-HSA-2559582 )
Recycling pathway of L1 (R-HSA-437239 )
CREB1 phosphorylation through NMDA receptor-mediated activation of RAS signaling (R-HSA-442742 )
RSK activation (R-HSA-444257 )
Gastrin-CREB signalling pathway via PKC and MAPK (R-HSA-881907 )
ERK/MAPK targets (R-HSA-198753 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Ethanol DMDRQZU Approved Ribosomal protein S6 kinase alpha-1 (RPS6KA1) affects the response to substance of Ethanol. [22]
Insulin DMB7CE0 Approved Ribosomal protein S6 kinase alpha-1 (RPS6KA1) increases the Chromosomal abnormalities and abnormal gene carriers ADR of Insulin. [23]
------------------------------------------------------------------------------------
20 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [1]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [2]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [3]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [4]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [5]
Quercetin DM3NC4M Approved Quercetin increases the expression of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [6]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [7]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [8]
Testosterone DM7HUNW Approved Testosterone increases the expression of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [8]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [9]
Selenium DM25CGV Approved Selenium increases the expression of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [10]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [11]
Diclofenac DMPIHLS Approved Diclofenac affects the expression of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [9]
Pioglitazone DMKJ485 Approved Pioglitazone increases the expression of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [12]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [6]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the activity of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [15]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [17]
Purvalanol A DMNQ7TM Investigative Purvalanol A decreases the activity of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [20]
Fasudil DMTCNOM Investigative Fasudil decreases the activity of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [21]
SU 6656 DMF1P6W Investigative SU 6656 decreases the activity of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [20]
------------------------------------------------------------------------------------
⏷ Show the Full List of 20 Drug(s)
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the phosphorylation of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [13]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [16]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A increases the phosphorylation of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [18]
Rapamycin Immunosuppressant Drug DM678IB Investigative Rapamycin Immunosuppressant Drug increases the phosphorylation of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [19]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
DNCB DMDTVYC Phase 2 DNCB affects the binding of Ribosomal protein S6 kinase alpha-1 (RPS6KA1). [14]
------------------------------------------------------------------------------------

References

1 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
2 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
3 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
4 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
5 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
6 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
7 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
8 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
9 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
10 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
11 Cannabidiol Activates Neuronal Precursor Genes in Human Gingival Mesenchymal Stromal Cells. J Cell Biochem. 2017 Jun;118(6):1531-1546. doi: 10.1002/jcb.25815. Epub 2016 Dec 29.
12 Effects of metformin and pioglitazone combination on apoptosis and AMPK/mTOR signaling pathway in human anaplastic thyroid cancer cells. J Biochem Mol Toxicol. 2020 Oct;34(10):e22547. doi: 10.1002/jbt.22547. Epub 2020 Jun 26.
13 Inhibition of phosphatidylinositol 3-kinase-mediated glucose metabolism coincides with resveratrol-induced cell cycle arrest in human diffuse large B-cell lymphomas. Biochem Pharmacol. 2006 Nov 15;72(10):1246-56. doi: 10.1016/j.bcp.2006.08.009. Epub 2006 Sep 15.
14 Proteomic analysis of the cellular response to a potent sensitiser unveils the dynamics of haptenation in living cells. Toxicology. 2020 Dec 1;445:152603. doi: 10.1016/j.tox.2020.152603. Epub 2020 Sep 28.
15 Use of human stem cell derived cardiomyocytes to examine sunitinib mediated cardiotoxicity and electrophysiological alterations. Toxicol Appl Pharmacol. 2011 Nov 15;257(1):74-83. doi: 10.1016/j.taap.2011.08.020. Epub 2011 Aug 27.
16 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
17 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
18 Ochratoxin A exerts neurotoxicity in human astrocytes through mitochondria-dependent apoptosis and intracellular calcium overload. Toxicol Lett. 2019 Oct 1;313:42-49. doi: 10.1016/j.toxlet.2019.05.021. Epub 2019 May 30.
19 Rapamycin induces transactivation of the EGFR and increases cell survival. Oncogene. 2009 Mar 5;28(9):1187-96. doi: 10.1038/onc.2008.490. Epub 2009 Jan 19.
20 The specificities of protein kinase inhibitors: an update. Biochem J. 2003 Apr 1;371(Pt 1):199-204. doi: 10.1042/BJ20021535.
21 Specificity and mechanism of action of some commonly used protein kinase inhibitors. Biochem J. 2000 Oct 1;351(Pt 1):95-105.
22 L1 coupling to ankyrin and the spectrin-actin cytoskeleton modulates ethanol inhibition of L1 adhesion and ethanol teratogenesis. FASEB J. 2018 Mar;32(3):1364-1374. doi: 10.1096/fj.201700970. Epub 2018 Jan 3.
23 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.