Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTDSWXHT)
| DOT Name | Trafficking protein particle complex subunit 6B (TRAPPC6B) | ||||
|---|---|---|---|---|---|
| Synonyms | TRAPP complex subunit 6B | ||||
| Gene Name | TRAPPC6B | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| PDB ID | |||||
| Pfam ID | |||||
| Sequence | 
                                         
                        MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKD 
                    
                ELDIMKFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLTQMSAGKQYLEHASKYLA FTCGLIRGGLSNLGIKSIVTAEVSSMPACKFQVMIQKL  | 
            ||||
| Function | 
                                         
                        Component of a transport protein particle (TRAPP) complex that may function in specific stages of inter-organelle traffic. Specifically involved in the early development of neural circuitry, likely by controlling the frequency and amplitude of intracellular calcium transients implicated in the regulation of neuron differentiation and survival (Probable).
                        
                     
                                     | 
            ||||
| Tissue Specificity | Both isoforms are expressed ubiquitously (at transcript level), isoform 1 being the most predominant . Expressed in the fetal brain and different regions of the adult brain and spinal cord . | ||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
| 
                     2 Disease(s) Related to This DOT 
                                                
  | 
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 
                     10 Drug(s) Affected the Gene/Protein Processing of This DOT 
                                                
  | 
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
