Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTE8OLFN)
| DOT Name | Nucleoside diphosphate kinase homolog 5 (NME5) | ||||
|---|---|---|---|---|---|
| Synonyms | NDK-H 5; NDP kinase homolog 5; 3'-5' exonuclease NME5; EC 3.1.-.-; Inhibitor of p53-induced apoptosis-beta; IPIA-beta; Testis-specific nm23 homolog; nm23-H5 | ||||
| Gene Name | NME5 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| PDB ID | |||||
| EC Number | |||||
| Pfam ID | |||||
| Sequence |
MEISMPPPQIYVEKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPEQCSNFYVE
KYGKMFFPNLTAYMSSGPLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTD DLRNALHGSNDFAAAEREIRFMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQK PADPLIWLADWLLKNNPNKPKLCHHPIVEEPY |
||||
| Function |
Functions as part of axonemal radial spoke complexes that play an important part in the motility of sperm and cilia. Does not seem to have nucleoside diphosphate kinase (NDPK) activity. Confers protection from cell death by BAX and alters the cellular levels of several antioxidant enzymes including GPX5. May play a role in spermiogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species. Exhibits a 3'-5' exonuclease activity with a preference for single-stranded DNA, suggesting roles in DNA proofreading and repair.
|
||||
| Tissue Specificity | Specifically expressed in testis germinal cells. | ||||
Molecular Interaction Atlas (MIA) of This DOT
|
6 Disease(s) Related to This DOT
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
7 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
