Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEAMO6F)

DOT Name N-alpha-acetyltransferase 60 (NAA60)
Synonyms hNaa60; EC 2.3.1.259; Histone acetyltransferase type B protein 4; HAT4; EC 2.3.1.48; N-acetyltransferase 15; N-alpha-acetyltransferase F; NatF
Gene Name NAA60
UniProt ID
NAA60_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
5HGZ; 5HH0; 5HH1; 5ICV; 5ICW
EC Number
2.3.1.259; 2.3.1.48
Pfam ID
PF00583
Sequence
MTEVVPSSALSEVSLRLLCHDDIDTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYR
GAIVGMIVAEIKNRTKIHKEDGDILASNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESL
KDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFKQHHYLPYYYSIRGVLKDGFTYVLY
INGGHPPWTILDYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSR
TM
Function
N-alpha-acetyltransferase that specifically mediates the acetylation of N-terminal residues of the transmembrane proteins, with a strong preference for N-termini facing the cytosol. Displays N-terminal acetyltransferase activity towards a range of N-terminal sequences including those starting with Met-Lys, Met-Val, Met-Ala and Met-Met. Required for normal chromosomal segregation during anaphase. May also show histone acetyltransferase activity; such results are however unclear in vivo and would require additional experimental evidences.
BioCyc Pathway
MetaCyc:ENSG00000122390-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of N-alpha-acetyltransferase 60 (NAA60). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of N-alpha-acetyltransferase 60 (NAA60). [2]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of N-alpha-acetyltransferase 60 (NAA60). [3]
Temozolomide DMKECZD Approved Temozolomide increases the expression of N-alpha-acetyltransferase 60 (NAA60). [4]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of N-alpha-acetyltransferase 60 (NAA60). [5]
Tocopherol DMBIJZ6 Phase 2 Tocopherol decreases the expression of N-alpha-acetyltransferase 60 (NAA60). [6]
GALLICACID DM6Y3A0 Investigative GALLICACID decreases the expression of N-alpha-acetyltransferase 60 (NAA60). [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
4 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
5 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
6 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
7 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.