Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFFWB0C)

• DOT Name: Coiled-coil domain-containing protein 90B, mitochondrial (CCDC90B)
• Gene Name: CCDC90B
• UniProt ID: CC90B_HUMAN
• PDB ID: 6H9M
• Pfam ID: PF07798
• Sequence:
  MNSRQAWRLFLSQGRGDRWVSRPRGHFSPALRREFFTTTTKEGYDRRPVDITPLEQRKLT
  FDTHALVQDLETHGFDKTQAETIVSALTALSNVSLDTIYKEMVTQAQQEITVQQLMAHLD
  AIRKDMVILEKSEFANLRAENEKMKIELDQVKQQLMHETSRIRADNKLDINLERSRVTDM
  FTDQEKQLMETTTEFTKKDTQTKSIISETSNKIDAEIASLKTLMESNKLETIRYLAASVF
  TCLAIALGFYRFWK

Molecular Interaction Atlas (MIA) of This DOT

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Coiled-coil domain-containing protein 90B, mitochondrial (CCDC90B).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Coiled-coil domain-containing protein 90B, mitochondrial (CCDC90B).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Coiled-coil domain-containing protein 90B, mitochondrial (CCDC90B).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Coiled-coil domain-containing protein 90B, mitochondrial (CCDC90B).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Coiled-coil domain-containing protein 90B, mitochondrial (CCDC90B).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Coiled-coil domain-containing protein 90B, mitochondrial (CCDC90B).	[6]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Coiled-coil domain-containing protein 90B, mitochondrial (CCDC90B).	[7]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Coiled-coil domain-containing protein 90B, mitochondrial (CCDC90B).	[8]
Cidofovir	DMA13GD	Approved	Cidofovir decreases the expression of Coiled-coil domain-containing protein 90B, mitochondrial (CCDC90B).	[6]
Ifosfamide	DMCT3I8	Approved	Ifosfamide decreases the expression of Coiled-coil domain-containing protein 90B, mitochondrial (CCDC90B).	[6]
Clodronate	DM9Y6X7	Approved	Clodronate decreases the expression of Coiled-coil domain-containing protein 90B, mitochondrial (CCDC90B).	[6]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Coiled-coil domain-containing protein 90B, mitochondrial (CCDC90B).	[9]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Coiled-coil domain-containing protein 90B, mitochondrial (CCDC90B).	[1]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Coiled-coil domain-containing protein 90B, mitochondrial (CCDC90B).	[10]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Coiled-coil domain-containing protein 90B, mitochondrial (CCDC90B).	[8]

References

• [1] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [2] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [3] Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
• [4] Identification of novel biomarkers for doxorubicin-induced toxicity in human cardiomyocytes derived from pluripotent stem cells. Toxicology. 2015 Feb 3;328:102-11. doi: 10.1016/j.tox.2014.12.018. Epub 2014 Dec 18.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [7] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [8] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [9] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [10] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.