Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFTPOJ4)

DOT Name MARVEL domain-containing protein 3 (MARVELD3)
Gene Name MARVELD3
Related Disease
Lung adenocarcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Pancreatic cancer ( )
UniProt ID
MALD3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEDPSGAREPRARPRERDPGRRPHPDQGRTHDRPRDRPGDPRRKRSSDGNRRRDGDRDPE
RDQERDGNRDRNRDRERERERERDPDRGPRRDTHRDAGPRAGEHGVWEKPRQSRTRDGAR
GLTWDAAAPPGPAPWEAPEPPQPQRKGDPGRRRPESEPPSERYLPSTPRPGREEVEYYQS
EAEGLLECHKCKYLCTGRACCQMLEVLLNLLILACSSVSYSSTGGYTGITSLGGIYYYQF
GGAYSGFDGADGEKAQQLDVQFYQLKLPMVTVAMACSGALTALCCLFVAMGVLRVPWHCP
LLLVTEGLLDMLIAGGYIPALYFYFHYLSAAYGSPVCKERQALYQSKGYSGFGCSFHGAD
IGAGIFAALGIVVFALGAVLAIKGYRKVRKLKEKPAEMFEF
Function As a component of tight junctions, plays a role in paracellular ion conductivity.
KEGG Pathway
Tight junction (hsa04530 )

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Lung adenocarcinoma DISD51WR Strong Biomarker [1]
Lung cancer DISCM4YA Strong Biomarker [1]
Lung carcinoma DISTR26C Strong Biomarker [1]
Pancreatic cancer DISJC981 Strong Altered Expression [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of MARVEL domain-containing protein 3 (MARVELD3). [3]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of MARVEL domain-containing protein 3 (MARVELD3). [8]
------------------------------------------------------------------------------------
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of MARVEL domain-containing protein 3 (MARVELD3). [4]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of MARVEL domain-containing protein 3 (MARVELD3). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of MARVEL domain-containing protein 3 (MARVELD3). [6]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of MARVEL domain-containing protein 3 (MARVELD3). [7]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of MARVEL domain-containing protein 3 (MARVELD3). [9]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of MARVEL domain-containing protein 3 (MARVELD3). [10]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of MARVEL domain-containing protein 3 (MARVELD3). [11]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of MARVEL domain-containing protein 3 (MARVELD3). [12]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of MARVEL domain-containing protein 3 (MARVELD3). [13]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of MARVEL domain-containing protein 3 (MARVELD3). [14]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)

References

1 Genome-wide unmasking of epigenetically silenced genes in lung adenocarcinoma from smokers and never smokers.Carcinogenesis. 2014 Jun;35(6):1248-57. doi: 10.1093/carcin/bgt494. Epub 2014 Jan 7.
2 Downregulation of tight junction-associated MARVEL protein marvelD3 during epithelial-mesenchymal transition in human pancreatic cancer cells.Exp Cell Res. 2011 Oct 1;317(16):2288-98. doi: 10.1016/j.yexcr.2011.06.020. Epub 2011 Jul 8.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
5 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
8 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
9 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
10 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
11 New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
12 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
13 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
14 Probiotic Bacillus subtilis CW14 reduces disruption of the epithelial barrier and toxicity of ochratoxin A to Caco-2?cells. Food Chem Toxicol. 2019 Apr;126:25-33. doi: 10.1016/j.fct.2019.02.009. Epub 2019 Feb 11.