Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFUQB7A)

DOT Name Protein mono-ADP-ribosyltransferase PARP8 (PARP8)
Synonyms EC 2.4.2.-; ADP-ribosyltransferase diphtheria toxin-like 16; ARTD16; Poly polymerase 8; PARP-8
Gene Name PARP8
Related Disease
Breast carcinoma ( )
UniProt ID
PARP8_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.4.2.-
Pfam ID
PF00644
Sequence
MGMCSRQERIQKDIDVVIQKSRAEKDCLFADFRYSDSTFTFTYVGGPRSVSYSVHVSEDY
PDNTYVSSSENDEDVLVTTEPIPVIFHRIATELRKTNDINCCLSIKSKLQKENGEESRQN
STVEEDSEGDNDSEEFYYGGQVNYDGELHKHPQLEADLSAVREIYGPHAVSLREYGAIDD
VDIDLHIDVSFLDEEIAVAWEVIRTEPIIVRLHCSLTQYLNGPVPTVDVFQISTKERFGL
GHQLKKIMQTFVTQQWKQSKEKSNCLHNKKLSEKKVKSPLHLFSTLRRSPSYPPPGCGKS
KSKLKSEQDGISKTHKLLRRTCSSTVKTDDVCVTKSHRTFGRSLSSDPRAEQAMTAIKSH
KLLNRPCPAAVKSEECLTLKSHRLLTRSCSGDPRCEHNTNLKPHKLLSRSYSSNLRMEEL
YGLKNHKLLSKSYSSAPKSSKTELFKEPNAEGRRLSLTSGLIGILTPSSSSSSQLAPNGA
KCIPVRDRGFLVQTIEFAEQRIPVLNEYCVVCDEPHVFQNGPMLRPTVCERELCVFAFQT
LGVMNEAADEIATGAQVVDLLVSMCRSALESPRKVVIFEPYPSVVDPNDPQMLAFNPRKK
NYDRVMKALDSITSIREMTQAPYLEIKKQMDKQDPLAHPLLQWVISSNRSHIVKLPVNRQ
LKFMHTPHQFLLLSSPPAKESNFRAAKKLFGSTFAFHGSHIENWHSILRNGLVVASNTRL
QLHGAMYGSGIYLSPMSSISFGYSGMNKKQKVSAKDEPASSSKSSNTSQSQKKGQQSQFL
QSRNLKCIALCEVITSSDLHKHGEIWVVPNTDHVCTRFFFVYEDGQVGDANINTQEGGIH
KEILRVIGNQTATG
Function Mono-ADP-ribosyltransferase that mediates mono-ADP-ribosylation of target proteins.
Reactome Pathway
Maturation of nucleoprotein (R-HSA-9683610 )
Maturation of nucleoprotein (R-HSA-9694631 )
Nicotinamide salvaging (R-HSA-197264 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast carcinoma DIS2UE88 Strong Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Protein mono-ADP-ribosyltransferase PARP8 (PARP8). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Protein mono-ADP-ribosyltransferase PARP8 (PARP8). [9]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Protein mono-ADP-ribosyltransferase PARP8 (PARP8). [10]
------------------------------------------------------------------------------------
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Protein mono-ADP-ribosyltransferase PARP8 (PARP8). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Protein mono-ADP-ribosyltransferase PARP8 (PARP8). [4]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Protein mono-ADP-ribosyltransferase PARP8 (PARP8). [5]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Protein mono-ADP-ribosyltransferase PARP8 (PARP8). [6]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Protein mono-ADP-ribosyltransferase PARP8 (PARP8). [7]
PEITC DMOMN31 Phase 2 PEITC increases the expression of Protein mono-ADP-ribosyltransferase PARP8 (PARP8). [8]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Protein mono-ADP-ribosyltransferase PARP8 (PARP8). [7]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde increases the expression of Protein mono-ADP-ribosyltransferase PARP8 (PARP8). [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Association analysis identifies 65 new breast cancer risk loci.Nature. 2017 Nov 2;551(7678):92-94. doi: 10.1038/nature24284. Epub 2017 Oct 23.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
5 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
6 Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
7 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
8 Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
9 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
10 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
11 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.