General Information of Drug Off-Target (DOT) (ID: OTG4EK2P)

DOT Name Cilia- and flagella-associated protein 68 (CFAP68)
Gene Name CFAP68
UniProt ID
CFA68_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7UNG; 8J07
Pfam ID
PF06608
Sequence
MAASQCLCCSKFLFQRQNLACFLTNPHCGSLVNADGHGEVWTDWNNMSKFFQYGWRCTTN
ENTYSNRTLMGNWNQERYDLRNIVQPKPLPSQFGHYFETTYDTSYNNKMPLSTHRFKREP
HWFPGHQPELDPPRYKCTEKSTYMNSYSKP
Function Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia axoneme, which is required for motile cilia beating.

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Cilia- and flagella-associated protein 68 (CFAP68). [1]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Cilia- and flagella-associated protein 68 (CFAP68). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Cilia- and flagella-associated protein 68 (CFAP68). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Cilia- and flagella-associated protein 68 (CFAP68). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Cilia- and flagella-associated protein 68 (CFAP68). [5]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Cilia- and flagella-associated protein 68 (CFAP68). [6]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Cilia- and flagella-associated protein 68 (CFAP68). [7]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Cilia- and flagella-associated protein 68 (CFAP68). [8]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Cilia- and flagella-associated protein 68 (CFAP68). [9]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Cilia- and flagella-associated protein 68 (CFAP68). [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
3 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
4 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
7 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
8 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
9 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
10 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.