Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG9DI66)

DOT Name Zinc finger protein SNAI3 (SNAI3)
Synonyms Protein snail homolog 3; Zinc finger protein 293
Gene Name SNAI3
Related Disease
Adult germ cell tumor ( )
Adult glioblastoma ( )
Colorectal carcinoma ( )
Germ cell tumor ( )
Germ cell tumour ( )
Glioblastoma multiforme ( )
Non-small-cell lung cancer ( )
Melanoma ( )
Neoplasm ( )
UniProt ID
SNAI3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00096
Sequence
MPRSFLVKTHSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDLPQPWD
RSSAVACISLPLLPRIEEALGASGLDALEVSEVDPRASRAAIVPLKDSLNHLNLPPLLVL
PTRWSPTLGPDRHGAPEKLLGAERMPRAPGGFECFHCHKPYHTLAGLARHRQLHCHLQVG
RVFTCKYCDKEYTSLGALKMHIRTHTLPCTCKICGKAFSRPWLLQGHVRTHTGEKPYACS
HCSRAFADRSNLRAHLQTHSDAKKYRCRRCTKTFSRMSLLARHEESGCCPGP
Function
Seems to inhibit myoblast differentiation. Transcriptional repressor of E-box-dependent transactivation of downstream myogenic bHLHs genes. Binds preferentially to the canonical E-box sequences 5'-CAGGTG-3' and 5'-CACCTG-3'.

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adult germ cell tumor DISJUCQ7 Strong Altered Expression [1]
Adult glioblastoma DISVP4LU Strong Altered Expression [2]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [3]
Germ cell tumor DIS62070 Strong Altered Expression [1]
Germ cell tumour DISOF3TK Strong Altered Expression [1]
Glioblastoma multiforme DISK8246 Strong Altered Expression [2]
Non-small-cell lung cancer DIS5Y6R9 Strong Altered Expression [4]
Melanoma DIS1RRCY Limited Altered Expression [5]
Neoplasm DISZKGEW Limited Altered Expression [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Zinc finger protein SNAI3 (SNAI3). [6]
Arsenic DMTL2Y1 Approved Arsenic increases the methylation of Zinc finger protein SNAI3 (SNAI3). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Zinc finger protein SNAI3 (SNAI3). [12]
------------------------------------------------------------------------------------
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Zinc finger protein SNAI3 (SNAI3). [7]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Zinc finger protein SNAI3 (SNAI3). [9]
Testosterone DM7HUNW Approved Testosterone increases the expression of Zinc finger protein SNAI3 (SNAI3). [9]
Rosiglitazone DMILWZR Approved Rosiglitazone increases the expression of Zinc finger protein SNAI3 (SNAI3). [10]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Zinc finger protein SNAI3 (SNAI3). [11]
PMID27336223-Compound-5 DM6E50A Patented PMID27336223-Compound-5 increases the expression of Zinc finger protein SNAI3 (SNAI3). [10]
Nitrobenzanthrone DMN6L70 Investigative Nitrobenzanthrone increases the expression of Zinc finger protein SNAI3 (SNAI3). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 Identification and characterization of human SNAIL3 (SNAI3) gene in silico.Int J Mol Med. 2003 Mar;11(3):383-8.
2 Comparative genomics on SNAI1, SNAI2, and SNAI3 orthologs.Oncol Rep. 2005 Oct;14(4):1083-6.
3 FOXD4 induces tumor progression in colorectal cancer by regulation of the SNAI3/CDH1 axis.Cancer Biol Ther. 2018;19(11):1065-1071. doi: 10.1080/15384047.2018.1480291. Epub 2018 Sep 25.
4 MiR-940 inhibits TGF--induced epithelial-mesenchymal transition and cell invasion by targeting Snail in non-small cell lung cancer.J Cancer. 2019 Jun 2;10(12):2735-2744. doi: 10.7150/jca.31800. eCollection 2019.
5 Directed Dedifferentiation Using Partial Reprogramming Induces Invasive Phenotype in Melanoma Cells.Stem Cells. 2016 Apr;34(4):832-46. doi: 10.1002/stem.2284. Epub 2016 Jan 19.
6 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
7 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
8 Epigenetic changes in individuals with arsenicosis. Chem Res Toxicol. 2011 Feb 18;24(2):165-7. doi: 10.1021/tx1004419. Epub 2011 Feb 4.
9 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
10 PPARgamma controls CD1d expression by turning on retinoic acid synthesis in developing human dendritic cells. J Exp Med. 2006 Oct 2;203(10):2351-62.
11 The MT1G Gene in LUHMES Neurons Is a Sensitive Biomarker of Neurotoxicity. Neurotox Res. 2020 Dec;38(4):967-978. doi: 10.1007/s12640-020-00272-3. Epub 2020 Sep 1.
12 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
13 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.