Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGC56W3)

DOT Name	Protein odr-4 homolog (ODR4)
Synonyms	hODR-4; LAG1-interacting protein; Transactivated by transforming growth factor beta protein 1
Gene Name	ODR4
Related Disease	Coeliac disease ( ) Hepatitis C virus infection ( )
UniProt ID	ODR4_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF14778
Sequence	MGRTYIVEETVGQYLSNINLQGKAFVSGLLIGQCSSQKDYVILATRTPPKEEQSENLKHP KAKLDNLDEEWATEHACQVSRMLPGGLLVLGVFIITTLELANDFQNALRRLMFAVEKSIN RKRLWNFTEEEVSERVTLHICASTKKIFCRTYDIHDPKSSARPADWKYQSGLSSSWLSLE CTVHINIHIPLSATSVSYTLEKNTKNGLTRWAKEIENGVYLINGQVKDEDCDLLEGQKKS SRGNTQATSHSFDVRVLTQLLLNSDHRSTATVQICSGSVNLKGAVKCRAYIHSSKPKVKD AVQAVKRDILNTVADRCEMLFEDLLLNEIPEKKDSEKEFHVLPYRVFVPLPGSTVMLCDY KFDDESAEEIRDHFMEMLDHTIQIEDLEIAEETNTACMSSSMNSQASLDNTDDEQPKQPI KTTMLLKIQQNIGVIAAFTVAVLAAGISFHYFSD
Function	May play a role in the trafficking of a subset of G-protein coupled receptors.
Tissue Specificity	Ubiquitously expressed.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Coeliac disease	DISIY60C	Strong	Biomarker	[1]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Protein odr-4 homolog (ODR4).	[3]
------------------------------------------------------------------------------------

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Protein odr-4 homolog (ODR4).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Protein odr-4 homolog (ODR4).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin increases the expression of Protein odr-4 homolog (ODR4).	[6]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Protein odr-4 homolog (ODR4).	[7]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Protein odr-4 homolog (ODR4).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Protein odr-4 homolog (ODR4).	[9]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Protein odr-4 homolog (ODR4).	[10]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of Protein odr-4 homolog (ODR4).	[11]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Drug(s)

References

1	Serum intestinal fatty acid-binding protein in the noninvasive diagnosis of celiac disease.APMIS. 2018 Mar;126(3):186-190. doi: 10.1111/apm.12800. Epub 2018 Jan 31.
2	Impact of soluble CD26 on treatment outcome and hepatitis C virus-specific T cells in chronic hepatitis C virus genotype 1 infection.PLoS One. 2013;8(2):e56991. doi: 10.1371/journal.pone.0056991. Epub 2013 Feb 20.
3	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4	Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
5	Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
6	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
7	Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
8	Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
9	New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
10	Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
11	Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.