General Information of Drug Off-Target (DOT) (ID: OTGPKZBA)

DOT Name Zinc finger protein ZIC 3
Synonyms Zinc finger protein 203; Zinc finger protein of the cerebellum 3
Gene Name ZIC3
Related Disease
Heterotaxy, visceral, 1, X-linked ( )
VACTERL association, X-linked, with or without hydrocephalus ( )
UniProt ID
ZIC3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2EJ4; 2RPC
Pfam ID
PF00096 ; PF18366
Sequence
MTMLLDGGPQFPGLGVGSFGAPRHHEMPNREPAGMGLNPFGDSTHAAAAAAAAAAFKLSP
AAAHDLSSGQSSAFTPQGSGYANALGHHHHHHHHHHHTSQVPSYGGAASAAFNSTREFLF
RQRSSGLSEAASGGGQHGLFAGSASSLHAPAGIPEPPSYLLFPGLHEQGAGHPSPTGHVD
NNQVHLGLRGELFGRADPYRPVASPRTDPYAAGAQFPNYSPMNMNMGVNVAAHHGPGAFF
RYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWE
ECPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKC
EFEGCDRRFANSSDRKKHMHVHTSDKPYICKVCDKSYTHPSSLRKHMKVHESQGSDSSPA
ASSGYESSTPPAIASANSKDTTKTPSAVQTSTSHNPGLPPNFNEWYV
Function
Acts as a transcriptional activator. Required in the earliest stages in both axial midline development and left-right (LR) asymmetry specification. Binds to the minimal GLI-consensus sequence 5'-GGGTGGTC-3'.
KEGG Pathway
Sig.ling pathways regulating pluripotency of stem cells (hsa04550 )
Reactome Pathway
Transcriptional regulation of pluripotent stem cells (R-HSA-452723 )
POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation (R-HSA-2892247 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Heterotaxy, visceral, 1, X-linked DIS01H96 Definitive X-linked recessive [1]
VACTERL association, X-linked, with or without hydrocephalus DISGDBX3 Definitive X-linked recessive [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Zinc finger protein ZIC 3. [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Zinc finger protein ZIC 3. [7]
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of Zinc finger protein ZIC 3. [8]
------------------------------------------------------------------------------------
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Zinc finger protein ZIC 3. [3]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Zinc finger protein ZIC 3. [4]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Zinc finger protein ZIC 3. [5]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Zinc finger protein ZIC 3. [6]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Zinc finger protein ZIC 3. [6]
Belinostat DM6OC53 Phase 2 Belinostat increases the expression of Zinc finger protein ZIC 3. [6]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Zinc finger protein ZIC 3. [9]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 Flexible and scalable diagnostic filtering of genomic variants using G2P with Ensembl VEP. Nat Commun. 2019 May 30;10(1):2373. doi: 10.1038/s41467-019-10016-3.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
4 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
5 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
6 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
7 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
8 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
9 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.