Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTH3V11B)

DOT Name	Synaptotagmin-8 (SYT8)
Synonyms	Synaptotagmin VIII; SytVIII
Gene Name	SYT8
Related Disease	Gastric cancer ( ) Stomach cancer ( )
UniProt ID	SYT8_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00168
Sequence	MGHPPVSPSAPAPAGTTAIPGLIPDLVAGTPWPRWALIAGALAAGVLLVSCLLCAACCCC RRHRKKPRDKESVGLGSARGTTTTHLVQPDVDGLESSPGDAQQWGCLQLSLEFDFGSQEI RVGLRQAADLRPGGTVDPYARVSVSTQAGHRHETKVHRGTLCPVFDETCCFHIPQAELPG ATLQVQLFNFKRFSGHEPLGELRLPLGTVDLQHVLEHWYLLGPPAATQPEQVGELCFSLR YVPSSGRLTVVVLEARGLRPGLAEPYVKVQLMLNQRKWKKRKTATKKGTAAPYFNEAFTF LVPFSQVQNVDLVLAVWDRSLPLRTEPVGKVHLGARASGQPLQHWADMLAHARRPIAQRH PLRPAREVDRMLALQPRLRLRLPLPHS
Function	Involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues. Mediates Ca(2+)-regulation of exocytosis acrosomal reaction in sperm. May mediate Ca(2+)-regulation of exocytosis in insulin secreted cells.
Reactome Pathway	Clathrin-mediated endocytosis (R-HSA-8856828 ) Cargo recognition for clathrin-mediated endocytosis (R-HSA-8856825 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Gastric cancer	DISXGOUK	Limited	Biomarker	[1]
Stomach cancer	DISKIJSX	Limited	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Synaptotagmin-8 (SYT8).	[2]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Synaptotagmin-8 (SYT8).	[3]
Phenobarbital	DMXZOCG	Approved	Phenobarbital decreases the expression of Synaptotagmin-8 (SYT8).	[4]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Synaptotagmin-8 (SYT8).	[5]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Synaptotagmin-8 (SYT8).	[7]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Synaptotagmin-8 (SYT8).	[6]
------------------------------------------------------------------------------------

References

1	Significance of SYT8 For the Detection, Prediction, and Treatment of Peritoneal Metastasis From Gastric Cancer.Ann Surg. 2018 Mar;267(3):495-503. doi: 10.1097/SLA.0000000000002096.
2	Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
3	Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
4	Dose- and time-dependent effects of phenobarbital on gene expression profiling in human hepatoma HepaRG cells. Toxicol Appl Pharmacol. 2009 Feb 1;234(3):345-60.
5	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
6	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
7	CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.