Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHK3EGZ)

DOT Name Probable ATP-dependent RNA helicase DDX53 (DDX53)
Synonyms EC 3.6.4.13; Cancer-associated gene protein; Cancer/testis antigen 26; CT26; DEAD box protein 53; DEAD box protein CAGE
Gene Name DDX53
Related Disease
Colon adenocarcinoma ( )
Liver cirrhosis ( )
Adenocarcinoma ( )
Adult lymphoma ( )
Advanced cancer ( )
Alcohol dependence ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Carcinoma ( )
Cervical cancer ( )
Cervical carcinoma ( )
Colitis ( )
Colon cancer ( )
Colon carcinoma ( )
Colonic neoplasm ( )
Colorectal carcinoma ( )
Colorectal neoplasm ( )
Depression ( )
Dilated cardiomyopathy 1A ( )
Duodenal ulcer ( )
Endometrial cancer ( )
Endometrial carcinoma ( )
Gastric cancer ( )
Gastric neoplasm ( )
Hepatocellular carcinoma ( )
Herpes simplex infection ( )
High blood pressure ( )
Lung adenocarcinoma ( )
Lymphoma ( )
Malignant soft tissue neoplasm ( )
Metastatic malignant neoplasm ( )
Non-small-cell lung cancer ( )
Ovarian neoplasm ( )
Pediatric lymphoma ( )
Peptic ulcer ( )
Retinoblastoma ( )
Sarcoma ( )
Stomach cancer ( )
Substance abuse ( )
leukaemia ( )
Leukemia ( )
Lung cancer ( )
Lung carcinoma ( )
Alcohol use disorder ( )
Autism spectrum disorder ( )
Melanoma ( )
Mental disorder ( )
Obsolete male infertility with azoospermia or oligozoospermia due to single gene mutation ( )
Parkinson disease ( )
Periodontitis ( )
UniProt ID
DDX53_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3IUY; 8KCA
EC Number
3.6.4.13
Pfam ID
PF00270 ; PF00271 ; PF00013
Sequence
MSHWAPEWKRAEANPRDLGASWDVRGSRGSGWSGPFGHQGPRAAGSREPPLCFKIKNNMV
GVVIGYSGSKIKDLQHSTNTKIQIINGESEAKVRIFGNREMKAKAKAAIETLIRKQESYN
SESSVDNAASQTPIGRNLGRNDIVGEAEPLSNWDRIRAAVVECEKRKWADLPPVKKNFYI
ESKATSCMSEMQVINWRKENFNITCDDLKSGEKRLIPKPTCRFKDAFQQYPDLLKSIIRV
GIVKPTPIQSQAWPIILQGIDLIVVAQTGTGKTLSYLMPGFIHLDSQPISREQRNGPGML
VLTPTRELALHVEAECSKYSYKGLKSICIYGGRNRNGQIEDISKGVDIIIATPGRLNDLQ
MNNSVNLRSITYLVIDEADKMLDMEFEPQIRKILLDVRPDRQTVMTSATWPDTVRQLALS
YLKDPMIVYVGNLNLVAVNTVKQNIIVTTEKEKRALTQEFVENMSPNDKVIMFVSQKHIA
DDLSSDFNIQGISAESLHGNSEQSDQERAVEDFKSGNIKILITTDIVSRGLDLNDVTHVY
NYDFPRNIDVYVHRVGYIGRTGKTGTSVTLITQRDSKMAGELIKILDRANQSVPEDLVVM
AEQYKLNQQKRHRETRSRKPGQRRKEFYFLS
Tissue Specificity Expressed in testis. Wide expression in various cancer tissues and cancer cell lines.

Molecular Interaction Atlas (MIA) of This DOT

51 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Colon adenocarcinoma DISDRE0J Definitive Biomarker [1]
Liver cirrhosis DIS4G1GX Definitive Genetic Variation [2]
Adenocarcinoma DIS3IHTY Strong Biomarker [3]
Adult lymphoma DISK8IZR Strong Genetic Variation [4]
Advanced cancer DISAT1Z9 Strong Biomarker [5]
Alcohol dependence DIS4ZSCO Strong Genetic Variation [6]
Breast cancer DIS7DPX1 Strong Biomarker [7]
Breast carcinoma DIS2UE88 Strong Biomarker [8]
Breast neoplasm DISNGJLM Strong Biomarker [9]
Carcinoma DISH9F1N Strong Biomarker [10]
Cervical cancer DISFSHPF Strong Biomarker [11]
Cervical carcinoma DIST4S00 Strong Biomarker [11]
Colitis DISAF7DD Strong Biomarker [12]
Colon cancer DISVC52G Strong Biomarker [13]
Colon carcinoma DISJYKUO Strong Biomarker [14]
Colonic neoplasm DISSZ04P Strong Biomarker [15]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [16]
Colorectal neoplasm DISR1UCN Strong Genetic Variation [17]
Depression DIS3XJ69 Strong Altered Expression [18]
Dilated cardiomyopathy 1A DIS0RK9Z Strong Genetic Variation [19]
Duodenal ulcer DISNHHCN Strong Biomarker [20]
Endometrial cancer DISW0LMR Strong Biomarker [21]
Endometrial carcinoma DISXR5CY Strong Biomarker [21]
Gastric cancer DISXGOUK Strong Biomarker [20]
Gastric neoplasm DISOKN4Y Strong Posttranslational Modification [22]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [23]
Herpes simplex infection DISL1SAV Strong Biomarker [24]
High blood pressure DISY2OHH Strong Genetic Variation [25]
Lung adenocarcinoma DISD51WR Strong Biomarker [26]
Lymphoma DISN6V4S Strong Genetic Variation [4]
Malignant soft tissue neoplasm DISTC6NO Strong Biomarker [27]
Metastatic malignant neoplasm DIS86UK6 Strong Biomarker [28]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [29]
Ovarian neoplasm DISEAFTY Strong Biomarker [30]
Pediatric lymphoma DIS51BK2 Strong Genetic Variation [4]
Peptic ulcer DISL8XZI Strong Genetic Variation [31]
Retinoblastoma DISVPNPB Strong Altered Expression [32]
Sarcoma DISZDG3U Strong Biomarker [27]
Stomach cancer DISKIJSX Strong Biomarker [20]
Substance abuse DIS327VW Strong Genetic Variation [33]
leukaemia DISS7D1V moderate Biomarker [34]
Leukemia DISNAKFL moderate Biomarker [34]
Lung cancer DISCM4YA moderate Biomarker [35]
Lung carcinoma DISTR26C moderate Biomarker [36]
Alcohol use disorder DISMB65Y Limited Biomarker [37]
Autism spectrum disorder DISXK8NV Limited Biomarker [38]
Melanoma DIS1RRCY Limited Biomarker [39]
Mental disorder DIS3J5R8 Limited Genetic Variation [40]
Obsolete male infertility with azoospermia or oligozoospermia due to single gene mutation DIS56JR8 Limited X-linked [41]
Parkinson disease DISQVHKL Limited Biomarker [42]
Periodontitis DISI9JOI Limited Biomarker [43]
------------------------------------------------------------------------------------
⏷ Show the Full List of 51 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Gemcitabine DMSE3I7 Approved Probable ATP-dependent RNA helicase DDX53 (DDX53) affects the response to substance of Gemcitabine. [45]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Probable ATP-dependent RNA helicase DDX53 (DDX53). [44]
------------------------------------------------------------------------------------

References

1 Adrenergic Receptor Signaling Regulates the Response of Tumors to Ionizing Radiation.Radiat Res. 2019 Jun;191(6):585-589. doi: 10.1667/RR15193.1. Epub 2019 Apr 25.
2 ADH1B*2 allele is protective against alcoholism but not chronic liver disease in the Hungarian population.Addiction. 2010 May;105(5):891-6. doi: 10.1111/j.1360-0443.2009.02876.x. Epub 2010 Mar 2.
3 Calpain inhibitors ameliorate muscle wasting in a cachectic mouse model bearing CT26 colorectal adenocarcinoma.Oncol Rep. 2017 Mar;37(3):1601-1610. doi: 10.3892/or.2017.5396. Epub 2017 Jan 20.
4 Modulation of the tumor microenvironment by intratumoral administration of IMO-2125, a novel TLR9 agonist, for cancer immunotherapy.Int J Oncol. 2018 Sep;53(3):1193-1203. doi: 10.3892/ijo.2018.4456. Epub 2018 Jun 27.
5 Natural killer cell-mediated anticancer effects of an arabinogalactan derived from rice hull in CT26 colon cancer-bearing mice.Int J Biol Macromol. 2019 Mar 1;124:368-376. doi: 10.1016/j.ijbiomac.2018.11.200. Epub 2018 Nov 22.
6 Response to Oral Immediate-Release Opioids for Breakthrough Pain in Patients with Advanced Cancer with Adequately Controlled Background Pain.Oncologist. 2019 Jan;24(1):125-131. doi: 10.1634/theoncologist.2017-0583. Epub 2018 Sep 25.
7 A size-shrinkable nanoparticle-based combined anti-tumor and anti-inflammatory strategy for enhanced cancer therapy.Nanoscale. 2018 May 31;10(21):9957-9970. doi: 10.1039/c8nr01184b.
8 Synthesis and anticancer evaluation of new lipophilic 1,2,4 and 1,3,4-oxadiazoles.Eur J Med Chem. 2019 Mar 1;165:18-30. doi: 10.1016/j.ejmech.2019.01.001. Epub 2019 Jan 2.
9 Tumor vasculature remolding by thalidomide increases delivery and efficacy of cisplatin.J Exp Clin Cancer Res. 2019 Oct 28;38(1):427. doi: 10.1186/s13046-019-1366-x.
10 Inhibition of tumor growth and metastasis by EMMPRIN multiple antigenic peptide (MAP) vaccination is mediated by immune modulation.Oncoimmunology. 2016 Nov 29;6(1):e1261778. doi: 10.1080/2162402X.2016.1261778. eCollection 2017.
11 Role of DDX53 in taxol-resistance of cervix cancer cells invitro.Biochem Biophys Res Commun. 2018 Nov 30;506(3):641-647. doi: 10.1016/j.bbrc.2018.10.145. Epub 2018 Oct 26.
12 Inhibition of colon carcinogenesis by 2-methoxy-5-amino-N-hydroxybenzamide, a novel derivative of mesalamine.Gastroenterology. 2010 Jan;138(1):221-30. doi: 10.1053/j.gastro.2009.08.062. Epub 2009 Sep 6.
13 Salmonella-mediated therapy targeting indoleamine 2, 3-dioxygenase 1 (IDO) activates innate immunity and mitigates colorectal cancer growth.Cancer Gene Ther. 2020 Apr;27(3-4):235-245. doi: 10.1038/s41417-019-0089-7. Epub 2019 Mar 1.
14 3-O-Acetyloleanolic acid inhibits angiopoietin-1-induced angiogenesis and lymphangiogenesis via suppression of angiopoietin-1/Tie-2 signaling.Phytother Res. 2020 Feb;34(2):359-367. doi: 10.1002/ptr.6526. Epub 2019 Nov 3.
15 Auranofin Protects Intestine against Radiation Injury by Modulating p53/p21 Pathway and Radiosensitizes Human Colon Tumor.Clin Cancer Res. 2019 Aug 1;25(15):4791-4807. doi: 10.1158/1078-0432.CCR-18-2751. Epub 2019 Apr 2.
16 Effect of Chemokine (C-C Motif) Ligand 7 (CCL7) and Its Receptor (CCR2) Expression on Colorectal Cancer Behaviors.Int J Mol Sci. 2019 Feb 5;20(3):686. doi: 10.3390/ijms20030686.
17 Non-thermal plasma induces immunogenic cell death in vivo in murine CT26 colorectal tumors.Oncoimmunology. 2018 Jul 26;7(9):e1484978. doi: 10.1080/2162402X.2018.1484978. eCollection 2018.
18 Association Between History of Multiple Concussions and Health Outcomes Among Former College Football Players: 15-Year Follow-up From the NCAA Concussion Study (1999-2001).Am J Sports Med. 2018 Jun;46(7):1733-1741. doi: 10.1177/0363546518765121. Epub 2018 Apr 5.
19 Alcohol consumption and idiopathic dilated cardiomyopathy: a case control study.Am Heart J. 1998 May;135(5 Pt 1):833-7. doi: 10.1016/s0002-8703(98)70042-0.
20 Prevalence of Helicobacter pylori vacA, cagA, cagE, iceA, babA2 genotypes and correlation with clinical outcome in Turkish patients with dyspepsia.Helicobacter. 2006 Dec;11(6):574-80. doi: 10.1111/j.1523-5378.2006.00461.x.
21 Frequent immune responses to a cancer/testis antigen, CAGE, in patients with microsatellite instability-positive endometrial cancer.Clin Cancer Res. 2005 May 15;11(10):3949-57. doi: 10.1158/1078-0432.CCR-04-1702.
22 Promoter hypomethylation of a novel cancer/testis antigen gene CAGE is correlated with its aberrant expression and is seen in premalignant stage of gastric carcinoma.Biochem Biophys Res Commun. 2003 Jul 18;307(1):52-63. doi: 10.1016/s0006-291x(03)01121-5.
23 Structures and bioactivities of seven flavonoids from Osmanthus fragrans 'Jinqiu' essential oil extraction residues.Nat Prod Res. 2018 Mar;32(5):588-591. doi: 10.1080/14786419.2017.1318387. Epub 2017 Apr 21.
24 Ablation of tumor cells in vivo by direct injection of HSV-thymidine kinase retroviral vector and ganciclovir therapy.Ann N Y Acad Sci. 1999 Jun 30;880:352-65. doi: 10.1111/j.1749-6632.1999.tb09538.x.
25 Increased risk for atherosclerosis of various macrophage scavenger receptor 1 alleles.Genet Test Mol Biomarkers. 2009 Oct;13(5):583-7. doi: 10.1089/gtmb.2009.0048.
26 Selective Cu(I) complex with phosphine-peptide (SarGly) conjugate contra breast cancer: Synthesis, spectroscopic characterization and insight into cytotoxic action.J Inorg Biochem. 2018 Sep;186:162-175. doi: 10.1016/j.jinorgbio.2018.06.009. Epub 2018 Jun 18.
27 Murine carcinoma expressing carcinoembryonic antigen-like protein is restricted by antibody against neem leaf glycoprotein.Immunol Lett. 2014 Nov;162(1 Pt A):132-9. doi: 10.1016/j.imlet.2014.08.004. Epub 2014 Aug 13.
28 Deleterious synergistic effects of distress and surgery on cancer metastasis: Abolishment through an integrated perioperative immune-stimulating stress-inflammatory-reducing intervention.Brain Behav Immun. 2019 Aug;80:170-178. doi: 10.1016/j.bbi.2019.03.005. Epub 2019 Mar 6.
29 Significance of tumor-associated autoantibodies in the early diagnosis of lung cancer.Clin Respir J. 2018 Jun;12(6):2020-2028. doi: 10.1111/crj.12769. Epub 2018 Feb 15.
30 RGD delivery of truncated coagulase to tumor vasculature affords local thrombotic activity to induce infarction of tumors in mice.Sci Rep. 2017 Aug 15;7(1):8126. doi: 10.1038/s41598-017-05326-9.
31 Association between Helicobacter pylori genotypes and gastric disorders in relation to the cag pathogenicity island.Diagn Microbiol Infect Dis. 2007 Sep;59(1):7-16. doi: 10.1016/j.diagmicrobio.2007.03.019. Epub 2007 May 22.
32 The cancer/testis antigen CAGE with oncogenic potential stimulates cell proliferation by up-regulating cyclins D1 and E in an AP-1- and E2F-dependent manner.J Biol Chem. 2010 May 7;285(19):14475-85. doi: 10.1074/jbc.M109.084400. Epub 2010 Mar 10.
33 Wellbeing and mental health amongst medical students in Jordan: a descriptive study.Int Rev Psychiatry. 2019 Nov-Dec;31(7-8):619-625. doi: 10.1080/09540261.2019.1670402. Epub 2019 Oct 3.
34 Comparative studies of oxaliplatin-based platinum(iv) complexes in different in vitro and in vivo tumor models.Metallomics. 2017 Mar 22;9(3):309-322. doi: 10.1039/c6mt00226a.
35 CAGE Binds to Beclin1, Regulates Autophagic Flux and CAGE-Derived Peptide Confers Sensitivity to Anti-cancer Drugs in Non-small Cell Lung Cancer Cells.Front Oncol. 2018 Dec 10;8:599. doi: 10.3389/fonc.2018.00599. eCollection 2018.
36 Combination of DESI2 and endostatin gene therapy significantly improves antitumor efficacy by accumulating DNA lesions, inducing apoptosis and inhibiting angiogenesis.Exp Cell Res. 2018 Oct 1;371(1):50-62. doi: 10.1016/j.yexcr.2018.07.040. Epub 2018 Jul 26.
37 Stressors, psychological distress, and mental health problems amongst Brazilian medical students.Int Rev Psychiatry. 2019 Nov-Dec;31(7-8):603-607. doi: 10.1080/09540261.2019.1669335. Epub 2019 Oct 15.
38 Synaptic Dysfunction in Human Neurons With Autism-Associated Deletions in PTCHD1-AS.Biol Psychiatry. 2020 Jan 15;87(2):139-149. doi: 10.1016/j.biopsych.2019.07.014. Epub 2019 Jul 29.
39 DDX53 Regulates Cancer Stem Cell-Like Properties by Binding to SOX-2.Mol Cells. 2017 May 31;40(5):322-330. doi: 10.14348/molcells.2017.0001. Epub 2017 May 2.
40 A descriptive study of mental health and wellbeing among medical students in Portugal.Int Rev Psychiatry. 2019 Nov-Dec;31(7-8):574-578. doi: 10.1080/09540261.2019.1675283. Epub 2019 Oct 22.
41 A genomics approach to male infertility. Genet Med. 2020 Dec;22(12):1967-1975. doi: 10.1038/s41436-020-0916-0. Epub 2020 Jul 28.
42 Alpha-synuclein, alcohol use disorders, and Parkinson disease: a case-control study.Parkinsonism Relat Disord. 2009 Jul;15(6):430-4. doi: 10.1016/j.parkreldis.2008.11.011. Epub 2009 Feb 4.
43 Transcriptome analysis of periodontitis-associated fibroblasts by CAGE sequencing identified DLX5 and RUNX2 long variant as novel regulators involved in periodontitis.Sci Rep. 2016 Sep 20;6:33666. doi: 10.1038/srep33666.
44 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
45 Using Whole-Exome Sequencing to Identify Genetic Markers for Carboplatin and Gemcitabine-Induced Toxicities. Clin Cancer Res. 2016 Jan 15;22(2):366-73. doi: 10.1158/1078-0432.CCR-15-0964. Epub 2015 Sep 16.