Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTHW3GEI)
| DOT Name | Syntaxin-7 (STX7) | ||||
|---|---|---|---|---|---|
| Gene Name | STX7 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MSYTPGVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTN
QLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVA RVRASSRVSGSFPEDSSKERNLVSWESQTQPQVQVQDEEITEDDLRLIHERESSIRQLEA DIMDINEIFKDLGMMIHEQGDVIDSIEANVENAEVHVQQANQQLSRAADYQRKSRKTLCI IILILVIGVAIISLIIWGLNH |
||||
| Function |
May be involved in protein trafficking from the plasma membrane to the early endosome (EE) as well as in homotypic fusion of endocytic organelles. Mediates the endocytic trafficking from early endosomes to late endosomes and lysosomes.
|
||||
| Tissue Specificity | Highest expression is found in placenta followed by heart, skeletal muscle, kidney and brain. Low expression is found in pancreas, lung and liver. | ||||
| KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
|
4 Disease(s) Related to This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
3 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
10 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
