Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTI8ZAK8)
DOT Name | Peroxiredoxin-like 2C (PRXL2C) | ||||
---|---|---|---|---|---|
Synonyms | AhpC/TSA antioxidant enzyme domain-containing protein 1; Thioredoxin-like protein AAED1 | ||||
Gene Name | PRXL2C | ||||
Related Disease | |||||
UniProt ID | |||||
3D Structure | |||||
Pfam ID | |||||
Sequence |
MAAPAPVTRQVSGAAALVPAPSGPDSGQPLAAAVAELPVLDARGQRVPFGALFRERRAVV
VFVRHFLCYICKEYVEDLAKIPRSFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVD PEREIYKRLGMKRGEEIASSGQSPHIKSNLLSGSLQSLWRAVTGPLFDFQGDPAQQGGTL ILGPGNNIHFIHRDRNRLDHKPINSVLQLVGVQHVNFTNRPSVIHV |
||||
Function | May positively regulate ERK1/2 signaling and AKT1 activation leading to HIF1A up-regulation with an increased expression of glycolysis genes and enhanced glycolysis. | ||||
Tissue Specificity | Expressed in gastric tissues. | ||||
Molecular Interaction Atlas (MIA) of This DOT
4 Disease(s) Related to This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
6 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||
1 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||
References