General Information of Drug Off-Target (DOT) (ID: OTI8ZAK8)

DOT Name Peroxiredoxin-like 2C (PRXL2C)
Synonyms AhpC/TSA antioxidant enzyme domain-containing protein 1; Thioredoxin-like protein AAED1
Gene Name PRXL2C
Related Disease
Advanced cancer ( )
Attention deficit hyperactivity disorder ( )
Gastric cancer ( )
Stomach cancer ( )
UniProt ID
PXL2C_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13911
Sequence
MAAPAPVTRQVSGAAALVPAPSGPDSGQPLAAAVAELPVLDARGQRVPFGALFRERRAVV
VFVRHFLCYICKEYVEDLAKIPRSFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVD
PEREIYKRLGMKRGEEIASSGQSPHIKSNLLSGSLQSLWRAVTGPLFDFQGDPAQQGGTL
ILGPGNNIHFIHRDRNRLDHKPINSVLQLVGVQHVNFTNRPSVIHV
Function May positively regulate ERK1/2 signaling and AKT1 activation leading to HIF1A up-regulation with an increased expression of glycolysis genes and enhanced glycolysis.
Tissue Specificity Expressed in gastric tissues.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Altered Expression [1]
Attention deficit hyperactivity disorder DISL8MX9 Strong Genetic Variation [2]
Gastric cancer DISXGOUK Strong Biomarker [1]
Stomach cancer DISKIJSX Strong Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Peroxiredoxin-like 2C (PRXL2C). [3]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Peroxiredoxin-like 2C (PRXL2C). [4]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Peroxiredoxin-like 2C (PRXL2C). [4]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Peroxiredoxin-like 2C (PRXL2C). [5]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Peroxiredoxin-like 2C (PRXL2C). [6]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Peroxiredoxin-like 2C (PRXL2C). [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Coumarin DM0N8ZM Investigative Coumarin increases the phosphorylation of Peroxiredoxin-like 2C (PRXL2C). [8]
------------------------------------------------------------------------------------

References

1 AAED1 modulates proliferation and glycolysis in gastric cancer.Oncol Rep. 2018 Aug;40(2):1156-1164. doi: 10.3892/or.2018.6478. Epub 2018 Jun 7.
2 Identification of ADHD risk genes in extended pedigrees by combining linkage analysis and whole-exome sequencing.Mol Psychiatry. 2020 Sep;25(9):2047-2057. doi: 10.1038/s41380-018-0210-6. Epub 2018 Aug 16.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
5 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
6 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
7 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
8 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.