Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIX7RRB)

DOT Name Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 (HDDC3)
Synonyms EC 3.1.7.2; HD domain-containing protein 3; Metazoan SpoT homolog 1; MESH1; Penta-phosphate guanosine-3'-pyrophosphohydrolase; (ppGpp)ase
Gene Name HDDC3
Related Disease
Breast cancer ( )
Breast carcinoma ( )
UniProt ID
MESH1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3NR1; 5VXA
EC Number
3.1.7.2
Pfam ID
PF13328
Sequence
MGSEAAQLLEAADFAARKHRQQRRKDPEGTPYINHPIGVARILTHEAGITDIVVLQAALL
HDTVEDTDTTLDEVELHFGAQVRRLVEEVTDDKTLPKLERKRLQVEQAPHSSPGAKLVKL
ADKLYNLRDLNRCTPEGWSEHRVQEYFEWAAQVVKGLQGTNRQLEEALKHLFKQRGLTI
Function ppGpp hydrolyzing enzyme involved in starvation response.
KEGG Pathway
Purine metabolism (hsa00230 )
Metabolic pathways (hsa01100 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Limited Genetic Variation [1]
Breast carcinoma DIS2UE88 Limited Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 (HDDC3). [2]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 (HDDC3). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 (HDDC3). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 (HDDC3). [5]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 (HDDC3). [6]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 (HDDC3). [7]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 (HDDC3). [2]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 (HDDC3). [8]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 (HDDC3). [9]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 (HDDC3). [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1 (HDDC3). [10]
------------------------------------------------------------------------------------

References

1 MicroRNA related polymorphisms and breast cancer risk.PLoS One. 2014 Nov 12;9(11):e109973. doi: 10.1371/journal.pone.0109973. eCollection 2014.
2 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
3 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
4 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
7 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
8 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
9 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.