Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTJIK1RY)
| DOT Name | Ribonuclease K6 (RNASE6) | ||||
|---|---|---|---|---|---|
| Synonyms | RNase K6; EC 3.1.27.- | ||||
| Gene Name | RNASE6 | ||||
| UniProt ID | |||||
| 3D Structure | |||||
| PDB ID | |||||
| EC Number | |||||
| Pfam ID | |||||
| Sequence |
MVLCFPLLLLLLVLWGPVCPLHAWPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHC
KHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAA QYKFFIVACDPPQKSDPPYKLVPVHLDSIL |
||||
| Function |
Ribonuclease which shows a preference for the pyrimidines uridine and cytosine. Has potent antibacterial activity against a range of Gram-positive and Gram-negative bacteria, including P.aeruginosa, A.baumanii, M.luteus, S.aureus, E.faecalis, E.faecium, S.saprophyticus and E.coli. Causes loss of bacterial membrane integrity, and also promotes agglutination of Gram-negative bacteria. Probably contributes to urinary tract sterility. Bactericidal activity is independent of RNase activity.
|
||||
| Tissue Specificity |
Highly expressed in spleen (at protein level) . Has little or no expression in healthy kidneys (at protein level) . Detected in interstitial leukocytes in infected kidneys (at protein level) . Expressed in ureter where it localizes to urothelial and submucosal leukocytes (at protein level) . Strong expression in lung and thymus, and lower expression in heart, placenta, pancreas, liver, brain and skeletal muscle . Also expressed in monocytes and neutrophils .
|
||||
| Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
5 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||
References
