Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKB8D2B)

• DOT Name: Tetratricopeptide repeat protein 32 (TTC32)
• Synonyms: TPR repeat protein 32
• Gene Name: TTC32
• UniProt ID: TTC32_HUMAN
• Pfam ID: PF00515 ; PF13432 ; PF13181
• Sequence:
  MEGQRQESHATLTLAQAHFNNGEYAEAEALYSAYIRRCACAASSDESPGSKCSPEDLATA
  YNNRGQIKYFRVDFYEAMDDYTSAIEVQPNFEVPYYNRGLILYRLGYFDDALEDFKKVLD
  LNPGFQDATLSLKQTILDKEEKQRRNVAKNY

Molecular Interaction Atlas (MIA) of This DOT

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Tetratricopeptide repeat protein 32 (TTC32).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Tetratricopeptide repeat protein 32 (TTC32).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Tetratricopeptide repeat protein 32 (TTC32).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Tetratricopeptide repeat protein 32 (TTC32).	[4]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Tetratricopeptide repeat protein 32 (TTC32).	[5]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Tetratricopeptide repeat protein 32 (TTC32).	[6]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Tetratricopeptide repeat protein 32 (TTC32).	[7]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Tetratricopeptide repeat protein 32 (TTC32).	[8]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Tetratricopeptide repeat protein 32 (TTC32).	[9]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Tetratricopeptide repeat protein 32 (TTC32).	[10]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [5] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [6] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [7] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [8] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [9] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [10] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.