Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKELV1D)

• DOT Name: Aspartate beta-hydroxylase domain-containing protein 2 (ASPHD2)
• Synonyms: EC 1.14.11.-
• Gene Name: ASPHD2
• UniProt ID: ASPH2_HUMAN
• EC Number: 1.14.11.-
• Pfam ID: PF05118
• Sequence:
  MVWAPLGPPRTDCLTLLHTPSKDSPKMSLEWLVAWSWSLDGLRDCIATGIQSVRDCDTTA
  VITVACLLVLFVWYCYHVGREQPRPYVSVNSLMQAADANGLQNGYVYCQSPECVRCTHNE
  GLNQKLYHNLQEYAKRYSWSGMGRIHKGIREQGRYLNSRPSIQKPEVFFLPDLPTTPYFS
  RDAQKHDVEVLERNFQTILCEFETLYKAFSNCSLPQGWKMNSTPSGEWFTFYLVNQGVCV
  PRNCRKCPRTYRLLGSLRTCIGNNVFGNACISVLSPGTVITEHYGPTNIRIRCHLGLKTP
  NGCELVVGGEPQCWAEGRCLLFDDSFLHAAFHEGSAEDGPRVVFMVDLWHPNVAAAERQA
  LDFIFAPGR
• Function: May function as 2-oxoglutarate-dependent dioxygenase.

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Aspartate beta-hydroxylase domain-containing protein 2 (ASPHD2).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Aspartate beta-hydroxylase domain-containing protein 2 (ASPHD2).	[7]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Aspartate beta-hydroxylase domain-containing protein 2 (ASPHD2).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Aspartate beta-hydroxylase domain-containing protein 2 (ASPHD2).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Aspartate beta-hydroxylase domain-containing protein 2 (ASPHD2).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Aspartate beta-hydroxylase domain-containing protein 2 (ASPHD2).	[5]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Aspartate beta-hydroxylase domain-containing protein 2 (ASPHD2).	[6]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Aspartate beta-hydroxylase domain-containing protein 2 (ASPHD2).	[8]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Aspartate beta-hydroxylase domain-containing protein 2 (ASPHD2).	[9]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Aspartate beta-hydroxylase domain-containing protein 2 (ASPHD2).	[10]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [4] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [9] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [10] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.