Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLMA7AH)

DOT Name ATP-dependent RNA helicase DDX51 (DDX51)
Synonyms EC 3.6.4.13; DEAD box protein 51
Gene Name DDX51
Related Disease
Acute lymphocytic leukaemia ( )
Advanced cancer ( )
Childhood acute lymphoblastic leukemia ( )
Malignant mesothelioma ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Malignant pleural mesothelioma ( )
UniProt ID
DDX51_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
3.6.4.13
Pfam ID
PF00270 ; PF00271
Sequence
MALFYVARYPGPDAAAAAGPEGAEAGAHGRARALLERLQSRARERQQQREPAQTEAAAST
EPATRRRRRPRRRRRVNDAEPGSPEAPQGKRRKADGEDAGAESNEEAPGEPSAGSSEEAP
GEPSAGSSEEAPGERSTSASAEAAPDGPALEEAAGPLVPGLVLGGFGKRKAPKVQPFLPR
WLAEPNCVRRNVTEDLVPIEDIPDVHPDLQKQLRAHGISSYFPVQAAVIPALLESAACGF
LVGRGGYRPSDLCVSAPTGSGKTLAFVIPVVQALLSRVVCHIRALVVLPTKELAQQVSKV
FNIYTDATPLRVSLVTGQKSLAKEQESLVQKTADGYRCLADIVVATPGRLVDHIDQTPGF
SLQQLRFLIIDEADRMIDSMHQSWLPRVVAAAFQSEDPADPCALLQRRQAQAVTAASTCC
PQMPLQKLLFSATLTQNPEKLQQLGLHQPRLFSTGLAHRGLEDTDGDGDSGKYAFPVGLT
HHYVPCSLSSKPLVVLHLVLEMGFSRVLCFTNSRENSHRLFLLVQAFGGVDVAEFSSRYG
PGQRRMILKQFEQGKIQLLISTDATARGIDVQGVELVVNYDAPQYLRTYVHRVGRTARAG
KTGQAFTLLLKVQERRFLRMLTEAGAPELQRHELSSKLLQPLVPRYEEALSQLEESVKEE
RKQRAA
Function ATP-binding RNA helicase involved in the biogenesis of 60S ribosomal subunits.

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute lymphocytic leukaemia DISPX75S Strong Posttranslational Modification [1]
Advanced cancer DISAT1Z9 Strong Biomarker [2]
Childhood acute lymphoblastic leukemia DISJ5D6U Strong Posttranslational Modification [1]
Malignant mesothelioma DISTHJGH Strong Biomarker [3]
Neoplasm DISZKGEW Strong Altered Expression [2]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [2]
Malignant pleural mesothelioma DIST2R60 Limited Biomarker [3]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of ATP-dependent RNA helicase DDX51 (DDX51). [4]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of ATP-dependent RNA helicase DDX51 (DDX51). [12]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of ATP-dependent RNA helicase DDX51 (DDX51). [14]
------------------------------------------------------------------------------------
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of ATP-dependent RNA helicase DDX51 (DDX51). [5]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of ATP-dependent RNA helicase DDX51 (DDX51). [6]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of ATP-dependent RNA helicase DDX51 (DDX51). [7]
Estradiol DMUNTE3 Approved Estradiol increases the expression of ATP-dependent RNA helicase DDX51 (DDX51). [8]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of ATP-dependent RNA helicase DDX51 (DDX51). [9]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of ATP-dependent RNA helicase DDX51 (DDX51). [10]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of ATP-dependent RNA helicase DDX51 (DDX51). [11]
Tamibarotene DM3G74J Phase 3 Tamibarotene affects the expression of ATP-dependent RNA helicase DDX51 (DDX51). [6]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of ATP-dependent RNA helicase DDX51 (DDX51). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)

References

1 Large-scale CpG methylation analysis identifies novel candidate genes and reveals methylation hotspots in acute lymphoblastic leukemia. Cancer Res. 2007 Mar 15;67(6):2617-25.
2 The DEAD-box RNA helicase 51 controls non-small cell lung cancer proliferation by regulating cell cycle progression via multiple pathways.Sci Rep. 2016 May 20;6:26108. doi: 10.1038/srep26108.
3 Comprehensive genomic analysis of malignant pleural mesothelioma identifies recurrent mutations, gene fusions and splicing alterations.Nat Genet. 2016 Apr;48(4):407-16. doi: 10.1038/ng.3520. Epub 2016 Feb 29.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
6 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
7 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
8 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
9 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
10 Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
11 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
12 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
13 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
14 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.