Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLZC371)

• DOT Name: Developmental pluripotency-associated 5 protein (DPPA5)
• Synonyms: hDPPA5; Embryonal stem cell-specific gene 1 protein; ESG-1
• Gene Name: DPPA5
• UniProt ID: DPPA5_HUMAN
• Pfam ID: PF16005
• Sequence:
  MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVSKAMLELKAL
  ESSDLTEVVVYGSYLYKLRTKWMLQSMAEWHRQRQERGMLKLAEAMNALELGPWMK
• Function: Involved in the maintenance of embryonic stem (ES) cell pluripotency. Dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. Associates with specific target mRNAs.

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Developmental pluripotency-associated 5 protein (DPPA5).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Developmental pluripotency-associated 5 protein (DPPA5).	[4]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Developmental pluripotency-associated 5 protein (DPPA5).	[2]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Developmental pluripotency-associated 5 protein (DPPA5).	[3]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Developmental pluripotency-associated 5 protein (DPPA5).	[3]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of Developmental pluripotency-associated 5 protein (DPPA5).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Developmental pluripotency-associated 5 protein (DPPA5).	[5]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Developmental pluripotency-associated 5 protein (DPPA5).	[6]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [3] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] The Effects of Combined Exposure to Bisphenols and Perfluoroalkyls on Human Perinatal Stem Cells and the Potential Implications for Health Outcomes. Int J Mol Sci. 2023 Oct 9;24(19):15018. doi: 10.3390/ijms241915018.
• [6] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.