Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMKBNDD)

• DOT Name: Uncharacterized protein C6orf47 (C6ORF47)
• Synonyms: Protein G4
• Gene Name: C6ORF47
• Related Disease:
  Hashimoto thyroiditis
  Thyroid gland papillary carcinoma
  Adult glioblastoma
  Advanced cancer
  Coeliac disease
  Glioblastoma multiforme
  Lymphoma, non-Hodgkin, familial
  Non-hodgkin lymphoma
  Rheumatoid arthritis
  Type-1 diabetes
  Influenza
• UniProt ID: CF047_HUMAN
• Pfam ID: PF15576
• Sequence:
  MFLRRLGGWLPRPWGRRKPMRPDPPYPEPRRVDSSSENSGSDWDSAPETMEDVGHPKTKD
  SGALRVSGAASEPSKEEPQVEQLGSKRMDSLKWDQPISSTQESGRLEAGGASPKLRWDHV
  DSGGTRRPGVSPEGGLSVPGPGAPLEKPGRREKLLGWLRGEPGAPSRYLGGPEECLQIST
  NLTLHLLELLASALLALCSRPLRAALDTLGLRGPLGLWLHGLLSFLAALHGLHAVLSLLT
  AHPLHFACLFGLLQALVLAVSLREPNGDEAATDWESEGLEREGEEQRGDPGKGL

Molecular Interaction Atlas (MIA) of This DOT

11 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hashimoto thyroiditis	DIS77CDF	Definitive	Genetic Variation	[1]
Thyroid gland papillary carcinoma	DIS48YMM	Definitive	Genetic Variation	[1]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Coeliac disease	DISIY60C	Strong	Genetic Variation	[3]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[2]
Lymphoma, non-Hodgkin, familial	DISCXYIZ	Strong	Genetic Variation	[3]
Non-hodgkin lymphoma	DISS2Y8A	Strong	Genetic Variation	[3]
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[4]
Type-1 diabetes	DIS7HLUB	Strong	Genetic Variation	[5]
Influenza	DIS3PNU3	moderate	Biomarker	[6]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Uncharacterized protein C6orf47 (C6ORF47).	[7]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Uncharacterized protein C6orf47 (C6ORF47).	[8]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Uncharacterized protein C6orf47 (C6ORF47).	[9]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate affects the expression of Uncharacterized protein C6orf47 (C6ORF47).	[10]
Niclosamide	DMJAGXQ	Approved	Niclosamide affects the expression of Uncharacterized protein C6orf47 (C6ORF47).	[12]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Uncharacterized protein C6orf47 (C6ORF47).	[13]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Uncharacterized protein C6orf47 (C6ORF47).	[15]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Uncharacterized protein C6orf47 (C6ORF47).	[16]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Uncharacterized protein C6orf47 (C6ORF47).	[11]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Uncharacterized protein C6orf47 (C6ORF47).	[14]

References

• [1] Diagnostic significance of CK19, galectin-3, CD56, TPO and Ki67 expression and BRAF mutation in papillary thyroid carcinoma.Oncol Lett. 2018 Apr;15(4):4269-4277. doi: 10.3892/ol.2018.7873. Epub 2018 Jan 26.
• [2] Toxicity and Efficacy of a Novel GADD34-expressing Oncolytic HSV-1 for the Treatment of Experimental Glioblastoma.Clin Cancer Res. 2018 Jun 1;24(11):2574-2584. doi: 10.1158/1078-0432.CCR-17-2954. Epub 2018 Mar 6.
• [3] Interactions within the MHC contribute to the genetic architecture of celiac disease.PLoS One. 2017 Mar 10;12(3):e0172826. doi: 10.1371/journal.pone.0172826. eCollection 2017.
• [4] A genome-wide association study suggests contrasting associations in ACPA-positive versus ACPA-negative rheumatoid arthritis.Ann Rheum Dis. 2011 Feb;70(2):259-65. doi: 10.1136/ard.2009.126821. Epub 2010 Dec 14.
• [5] A genome-wide association study identifies KIAA0350 as a type 1 diabetes gene.Nature. 2007 Aug 2;448(7153):591-4. doi: 10.1038/nature06010. Epub 2007 Jul 15.
• [6] Conserved HA-peptide NG34 formulated in pCMV-CTLA4-Ig reduces viral shedding in pigs after a heterosubtypic influenza virus SwH3N2 challenge.PLoS One. 2019 Mar 1;14(3):e0212431. doi: 10.1371/journal.pone.0212431. eCollection 2019.
• [7] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [8] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [9] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [10] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [11] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [12] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [13] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [14] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [15] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
• [16] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.