Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTMYCDCW)

• DOT Name: Testis-expressed protein 9 (TEX9)
• Gene Name: TEX9
• Related Disease:
  Esophageal squamous cell carcinoma
  Triple negative breast cancer
  Crohn disease
• UniProt ID: TEX9_HUMAN
• Sequence:
  MAGRSLCLTRSSVPGTPFPPPVQQPSTPGPDLLALEEEYKRLNAELQAKTADVVQQAKEI
  IRDRQEVRSRPVSTQMKSCDDEDDYSLRGLLPSEGIVHLHSETKPKTKNIDPVNKVQNKL
  HSANKGRKTNSSVKLKYSDVQTADDVAIPEDFSDFSLAKTISKIEGQLEEEGLPEYIDDI
  FSGVSNDIGTEAQIRFLKAKLHVMQEELDNVVCECNKKEDEIQNLKSQVKNFEEDFMRQQ
  RTINMQQSQVEKYKTLFEEANKKYDGLQQQLSSVERELENKRRLQKQAASSQSATEVRLN
  RALEEAEKYKLELSKLRQNNKDIANEEHKKIEVLKSENKKLEKQKGELMIGFKKQLKLID
  VLKRQKMHIEAAKMLSFTEEEFMKALEWGNS

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[1]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[2]
Crohn disease	DIS2C5Q8	Limited	Genetic Variation	[3]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Testis-expressed protein 9 (TEX9).	[4]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Testis-expressed protein 9 (TEX9).	[5]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Testis-expressed protein 9 (TEX9).	[6]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Testis-expressed protein 9 (TEX9).	[7]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Testis-expressed protein 9 (TEX9).	[8]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Testis-expressed protein 9 (TEX9).	[9]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Testis-expressed protein 9 (TEX9).	[10]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Testis-expressed protein 9 (TEX9).	[11]
Clorgyline	DMCEUJD	Approved	Clorgyline increases the expression of Testis-expressed protein 9 (TEX9).	[12]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Testis-expressed protein 9 (TEX9).	[13]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE decreases the expression of Testis-expressed protein 9 (TEX9).	[9]

References

• [1] TEX9 and eIF3b functionally synergize to promote the progression of esophageal squamous cell carcinoma.BMC Cancer. 2019 Sep 3;19(1):875. doi: 10.1186/s12885-019-6071-9.
• [2] An unbiased in vivo functional genomics screening approach in mice identifies novel tumor cell-based regulators of immune rejection.Cancer Immunol Immunother. 2017 Dec;66(12):1529-1544. doi: 10.1007/s00262-017-2047-2. Epub 2017 Aug 2.
• [3] Genome-wide association study for Crohn's disease in the Quebec Founder Population identifies multiple validated disease loci.Proc Natl Acad Sci U S A. 2007 Sep 11;104(37):14747-52. doi: 10.1073/pnas.0706645104. Epub 2007 Sep 5.
• [4] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [5] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [6] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [7] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [8] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [9] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [10] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [11] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [12] Anti-oncogenic and pro-differentiation effects of clorgyline, a monoamine oxidase A inhibitor, on high grade prostate cancer cells. BMC Med Genomics. 2009 Aug 20;2:55. doi: 10.1186/1755-8794-2-55.
• [13] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.