General Information of Drug Off-Target (DOT) (ID: OTNNK3VC)

DOT Name Immunoglobulin-like domain-containing receptor 2 (ILDR2)
Synonyms Angulin-3
Gene Name ILDR2
UniProt ID
ILDR2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF05624
Sequence
MDRVLLRWISLFWLTAMVEGLQVTVPDKKKVAMLFQPTVLRCHFSTSSHQPAVVQWKFKS
YCQDRMGESLGMSSTRAQSLSKRNLEWDPYLDCLDSRRTVRVVASKQGSTVTLGDFYRGR
EITIVHDADLQIGKLMWGDSGLYYCIITTPDDLEGKNEDSVELLVLGRTGLLADLLPSFA
VEIMPEWVFVGLVLLGVFLFFVLVGICWCQCCPHSCCCYVRCPCCPDSCCCPQALYEAGK
AAKAGYPPSVSGVPGPYSIPSVPLGGAPSSGMLMDKPHPPPLAPSDSTGGSHSVRKGYRI
QADKERDSMKVLYYVEKELAQFDPARRMRGRYNNTISELSSLHEEDSNFRQSFHQMRSKQ
FPVSGDLESNPDYWSGVMGGSSGASRGPSAMEYNKEDRESFRHSQPRSKSEMLSRKNFAT
GVPAVSMDELAAFADSYGQRPRRADGNSHEARGGSRFERSESRAHSGFYQDDSLEEYYGQ
RSRSREPLTDADRGWAFSPARRRPAEDAHLPRLVSRTPGTAPKYDHSYLGSARERQARPE
GASRGGSLETPSKRSAQLGPRSASYYAWSPPGTYKAGSSQDDQEDASDDALPPYSELELT
RGPSYRGRDLPYHSNSEKKRKKEPAKKTNDFPTRMSLVV
Function
May be involved in ER stress pathways with effects on lipid homeostasis and insulin secretion. With ILDR1 and LSR, involved in the maintain of the epithelial barrier function through the recruitment of MARVELD2/tricellulin to tricellular tight junctions. Also functions as a B7-like protein family member expressed on immune cells and inflamed tissue and with T-cell inhibitory activity. In the inner ear, may regulate alternative pre-mRNA splicing via binding to TRA2A, TRA2B and SRSF1.
Tissue Specificity
Expressed in testis, brain, pituitary, colon, heart, nerves, prostate, esophagus, lung liver and small intestine . Highly expressed in macrophages, also expressed in monocytes and at low levels in NK and NKT cells (at protein level) .

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Immunoglobulin-like domain-containing receptor 2 (ILDR2). [1]
------------------------------------------------------------------------------------
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Immunoglobulin-like domain-containing receptor 2 (ILDR2). [2]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Immunoglobulin-like domain-containing receptor 2 (ILDR2). [3]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Immunoglobulin-like domain-containing receptor 2 (ILDR2). [4]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Immunoglobulin-like domain-containing receptor 2 (ILDR2). [5]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Immunoglobulin-like domain-containing receptor 2 (ILDR2). [6]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Immunoglobulin-like domain-containing receptor 2 (ILDR2). [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
3 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
4 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
5 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
6 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.