Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTO5F8CF)

• DOT Name: Cell division cycle protein 20 homolog B (CDC20B)
• Gene Name: CDC20B
• Related Disease:
  Advanced cancer
  Neoplasm
• UniProt ID: CD20B_HUMAN
• Pfam ID: PF12894 ; PF00400
• Sequence:
  MEWKLERTAPRRVRTEEEMLWESIMRVLSKDLKQKRSQDSANVLDSVNATYSDFKSNFAK
  RLSAEVPVASSPITTRWQQSQTRALSSDSFGEEQSTTYLPEASGSVLKTPPEKETLTLGS
  RKEQLKTPSKGISETSNSALHFCKAPHAMDRDWKESVASKGQKCLKQLFVTQNVVQQANG
  KMQLCEQSECVWKGCKDGVRDESFHLKSSGDINDSILQPEVKIHITGLRNDYYLNILDWS
  FQNLVAIALGSAVYIWNGENHNGIENIDLSLTCNYISSVSWIKEGTCLAVGTSEGEVQLW
  DVVTKKRLRNMLGHLSVVGALSWNHFILSSGSRLGRVYHHDVRVAQHHVGTLRHKQAVCA
  LKWSPDGRLLSSGCSDGLLTIWPHDPGASAQGQPLKVITQSTAVKAMDWCPWQSGVLAIG
  GGMKDGRLHILDINAGKSIQTPSTNSQICSLIWLPKTKEIATGQGTPKNDVTVWTCPTVS
  RSGGFFGHRGRVLHLSLSPDQTRVFSAAADGTASVWNCY
• Function: Protein regulator of centriole-deuterosome disengagement and subsequently participates in the ciliogenesis in multiciliated cells (MCCs).
• Tissue Specificity: Expressed in multiciliated cells (MCCs).

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Definitive	Genetic Variation	[1]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[1]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Cell division cycle protein 20 homolog B (CDC20B).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Cell division cycle protein 20 homolog B (CDC20B).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Cell division cycle protein 20 homolog B (CDC20B).	[2]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Cell division cycle protein 20 homolog B (CDC20B).	[4]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Cell division cycle protein 20 homolog B (CDC20B).	[5]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Cell division cycle protein 20 homolog B (CDC20B).	[6]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of Cell division cycle protein 20 homolog B (CDC20B).	[6]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Cell division cycle protein 20 homolog B (CDC20B).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Cell division cycle protein 20 homolog B (CDC20B).	[8]

References

• [1] miR-449a: a potential therapeutic agent for cancer.Anticancer Drugs. 2017 Nov;28(10):1067-1078. doi: 10.1097/CAD.0000000000000555.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [4] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [5] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [6] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.