Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTO6U97G)

DOT Name Copine-8 (CPNE8)
Synonyms Copine VIII
Gene Name CPNE8
Related Disease
Prion disease ( )
Arthrogryposis ( )
Bipolar disorder ( )
UniProt ID
CPNE8_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00168 ; PF07002
Sequence
MDSRYNSTAGIGDLNQLSAAIPATRVEVSVSCRNLLDRDTFSKSDPICVLYVQGVGNKEW
REFGRTEVIDNTLNPDFVRKFILDYFFEERENLRFDLYDVDSKSPNLSKHDFLGQVFCTL
GEIVGSQGSRLEKPIVGIPGKKCGTIILTAEELNCCRDAVLMQFCANKLDKKDFFGKSDP
FLVFYRSNEDGSFTICHKTEVVKNTLNPVWQAFKISVRALCNGDYDRTIKVEVYDWDRDG
SHDFIGEFTTSYRELSRGQSQFNVYEVVNPKKKGKKKKYTNSGTVTLLSFLVETEVSFLD
YIKGGTQINFTVAIDFTASNGNPAQPTSLHYMNPYQLNAYGMALKAVGEIVQDYDSDKMF
PALGFGAKLPPDGRISHEFALNGNPQNPYCDGIEGVMEAYYRSLKSVQLYGPTNFAPVIN
HVARYASSVKDGSQYFVLLIVTDGVISDMAQTKESIVNASKLPMSIIIVGVGPAEFDAMV
ELDGDDVRVSSRGKYAERDIVQFVPFRDYIDRSGNHILSMARLAKDVLAEIPEQFLSYMR
ARGIKPSPAPPPYTPPTHVLQTQI
Function Probable calcium-dependent phospholipid-binding protein that may play a role in calcium-mediated intracellular processes.
Reactome Pathway
RHOD GTPase cycle (R-HSA-9013405 )
RHOQ GTPase cycle (R-HSA-9013406 )
RHOJ GTPase cycle (R-HSA-9013409 )
CDC42 GTPase cycle (R-HSA-9013148 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Prion disease DISOUMB0 Strong Altered Expression [1]
Arthrogryposis DISC81CM moderate Biomarker [2]
Bipolar disorder DISAM7J2 moderate Genetic Variation [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Copine-8 (CPNE8). [4]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Copine-8 (CPNE8). [5]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Copine-8 (CPNE8). [6]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Copine-8 (CPNE8). [7]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Copine-8 (CPNE8). [8]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Copine-8 (CPNE8). [9]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of Copine-8 (CPNE8). [10]
Melphalan DMOLNHF Approved Melphalan decreases the expression of Copine-8 (CPNE8). [11]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Copine-8 (CPNE8). [12]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Copine-8 (CPNE8). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)

References

1 A Copine family member, Cpne8, is a candidate quantitative trait gene for prion disease incubation time in mouse.Neurogenetics. 2010 May;11(2):185-91. doi: 10.1007/s10048-009-0219-8. Epub 2009 Oct 1.
2 Radiation hybrid mapping of 18 positional and physiological candidate genes for arthrogryposis multiplex congenita on porcine chromosome 5.Anim Genet. 2006 Jun;37(3):239-44. doi: 10.1111/j.1365-2052.2006.01447.x.
3 A genome-wide association study identifies two novel susceptibility loci and trans population polygenicity associated with bipolar disorder.Mol Psychiatry. 2018 Mar;23(3):639-647. doi: 10.1038/mp.2016.259. Epub 2017 Jan 24.
4 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
5 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
6 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
7 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
8 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
9 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
10 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
11 Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
12 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
13 Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.