Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOYUNHN)

DOT Name Pre-mRNA-processing factor 17 (CDC40)
Synonyms Cell division cycle 40 homolog; EH-binding protein 3; Ehb3; PRP17 homolog; hPRP17
Gene Name CDC40
Related Disease
Advanced cancer ( )
Hepatocellular carcinoma ( )
Myelodysplastic syndrome ( )
Pontocerebellar hypoplasia, type 15 ( )
UniProt ID
PRP17_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
5MQF; 5XJC; 5YZG; 5Z56; 5Z57; 6FF4; 6FF7; 6ICZ; 6ID0; 6ID1; 6QDV; 6ZYM; 7A5P; 7AAV; 7ABI; 7W59; 7W5A; 7W5B; 8C6J; 8CH6
Pfam ID
PF00400
Sequence
MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEV
AVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHI
NDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKK
FKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTI
LHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLS
GHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWD
TETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGA
VNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQS
MDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTT
KLYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD
Function Required for pre-mRNA splicing as component of the activated spliceosome. Plays an important role in embryonic brain development; this function does not require proline isomerization.
KEGG Pathway
Spliceosome (hsa03040 )
Reactome Pathway
mRNA Splicing - Major Pathway (R-HSA-72163 )
mRNA 3'-end processing (R-HSA-72187 )
RNA Polymerase II Transcription Termination (R-HSA-73856 )
Transport of Mature mRNA derived from an Intron-Containing Transcript (R-HSA-159236 )

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Altered Expression [1]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [1]
Myelodysplastic syndrome DISYHNUI Strong Biomarker [2]
Pontocerebellar hypoplasia, type 15 DIS9SOSA Limited Unknown [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Pre-mRNA-processing factor 17 (CDC40). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Pre-mRNA-processing factor 17 (CDC40). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Pre-mRNA-processing factor 17 (CDC40). [6]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Pre-mRNA-processing factor 17 (CDC40). [7]
Fluorouracil DMUM7HZ Approved Fluorouracil increases the expression of Pre-mRNA-processing factor 17 (CDC40). [7]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Pre-mRNA-processing factor 17 (CDC40). [8]
Resorcinol DMM37C0 Investigative Resorcinol decreases the expression of Pre-mRNA-processing factor 17 (CDC40). [9]
Aminohippuric acid DMUN54G Investigative Aminohippuric acid affects the expression of Pre-mRNA-processing factor 17 (CDC40). [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 HBx-induced MiR-1269b in NF-B dependent manner upregulates cell division cycle 40 homolog (CDC40) to promote proliferation and migration in hepatoma cells.J Transl Med. 2016 Jun 27;14(1):189. doi: 10.1186/s12967-016-0949-y.
2 miR-378 inhibits cell growth and enhances apoptosis in human myelodysplastic syndromes.Int J Oncol. 2016 Nov;49(5):1921-1930. doi: 10.3892/ijo.2016.3689. Epub 2016 Sep 13.
3 Mutations in Spliceosomal Genes PPIL1 and PRP17 Cause Neurodegenerative Pontocerebellar Hypoplasia with Microcephaly. Neuron. 2021 Jan 20;109(2):241-256.e9. doi: 10.1016/j.neuron.2020.10.035. Epub 2020 Nov 20.
4 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Analysis of the in vitro synergistic effect of 5-fluorouracil and cisplatin on cervical carcinoma cells. Int J Gynecol Cancer. 2006 May-Jun;16(3):1321-9.
8 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
9 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
10 Identification of molecular signatures predicting the carcinogenicity of polycyclic aromatic hydrocarbons (PAHs). Toxicol Lett. 2012 Jul 7;212(1):18-28. doi: 10.1016/j.toxlet.2012.04.013. Epub 2012 May 1.