Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPQB7B5)

• DOT Name: NOP protein chaperone 1 (NOPCHAP1)
• Gene Name: NOPCHAP1
• UniProt ID: NOPC1_HUMAN
• Pfam ID: PF15370
• Sequence:
  MEVHGKPKASPSCSSPTRDSSGVPVSKELLTAGSDGRGGIWDRLLINSQPKSRKTSTLQT
  VRIERSPLLDQVQTFLPQMARANEKLRKEMAAAPPGRFNIENIDGPHSKVIQMDVALFEM
  NQSDSKEVDSSEESSQDSSENSSESEDEDDSIPSEVTIDNIKLPNSEGGKGKIEVLDSPA
  SKKKK
• Function: Client-loading PAQosome/R2TP complex cofactor that selects NOP58 to promote box C/D small nucleolar ribonucleoprotein (snoRNP) assembly. Acts as a bridge between NOP58 and the R2TP complex via RUVBL1:RUVBL2.

Molecular Interaction Atlas (MIA) of This DOT

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of NOP protein chaperone 1 (NOPCHAP1).	[1]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of NOP protein chaperone 1 (NOPCHAP1).	[2]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of NOP protein chaperone 1 (NOPCHAP1).	[3]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of NOP protein chaperone 1 (NOPCHAP1).	[4]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of NOP protein chaperone 1 (NOPCHAP1).	[4]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of NOP protein chaperone 1 (NOPCHAP1).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of NOP protein chaperone 1 (NOPCHAP1).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of NOP protein chaperone 1 (NOPCHAP1).	[7]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of NOP protein chaperone 1 (NOPCHAP1).	[8]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of NOP protein chaperone 1 (NOPCHAP1).	[9]

References

• [1] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [2] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [3] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [4] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [5] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [6] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [7] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [8] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [9] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.