Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPY8R95)

• DOT Name: Photoreceptor ankyrin repeat protein (ANKRD33)
• Synonyms: Ankyrin repeat domain-containing protein 33
• Gene Name: ANKRD33
• Related Disease:
  Gastric adenocarcinoma
  Neoplasm
  Gastric neoplasm
• UniProt ID: PANKY_HUMAN
• Pfam ID: PF12796
• Sequence:
  MKVQPSVTCVASWGGIVHLEAFGDPVIVLRGAWAVPRVDCLIDTLRTPNASCMRKGTHLL
  VPCLEEEELALHRRRLDMSEALPCPGKETPTPGCRLGALYWACVHNDPTQLQAILDGGVS
  PEEATQVDSNGRTGLMVACYHGFQSVVALLSHCPFLDVNQQDKGGDTALMLAAQAGHVPL
  VSLLLNYYVGLDLERRDQRGLTALMKAAMRNRCADLTAVDPVRGKTALEWAVLTDSFDTV
  WRIRQLLRRPQVEQLSQHYKPEWPALSGLVAQAQAQAQVAPSLLERLQATLSLPFAPSPQ
  EGGVLDHLVTATTSLASPFVTTACHTLCPDHPPSLGTRSKSVPELLGTAPPPPLVPQSPP
  GSPQRSPWVFVPYQSPQGILSKCLQWLQPRDSTSPRPQVPKILLSKASSSSHQCQPKPSP
  SGHQSLALPLWRYQELRIEKRKQEEEARMAQK
• Function: Acts as a transcriptional repressor for CRX-activated photoreceptor gene regulation.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Gastric adenocarcinoma	DISWWLTC	Definitive	Biomarker	[1]
Neoplasm	DISZKGEW	Definitive	Biomarker	[1]
Gastric neoplasm	DISOKN4Y	Strong	Biomarker	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Photoreceptor ankyrin repeat protein (ANKRD33).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Photoreceptor ankyrin repeat protein (ANKRD33).	[6]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Photoreceptor ankyrin repeat protein (ANKRD33).	[3]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Photoreceptor ankyrin repeat protein (ANKRD33).	[4]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Photoreceptor ankyrin repeat protein (ANKRD33).	[5]

References

• [1] ANKRD33 is overexpressed in gastric adenocarcinoma and predictive for poor prognosis.Biosci Biotechnol Biochem. 2019 Nov;83(11):2075-2081. doi: 10.1080/09168451.2019.1642100. Epub 2019 Jul 17.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [4] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [5] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.