Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQ6KAV1)

DOT Name Major facilitator superfamily domain-containing protein 6 (MFSD6)
Synonyms Macrophage MHC class I receptor 2 homolog
Gene Name MFSD6
Related Disease
Measles ( )
mumps ( )
rubella ( )
UniProt ID
MFSD6_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF12832
Sequence
MADDKVAILTDDEEEQKRKYVLADPFNGISREPEPPSNETPSSTETSAIPEEEIDWIEKH
CVKINNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAPF
WGVVADRFKKGKIVLLFSLLCWVLFNLGIGFVKPATLRCVPKIRPTTHPTNASHQLTILP
TNSSFTSFLTISPKMREKRNLLETRLNVSDTVTLPTAPNMNSEPTLQPQTGEITNRMMDL
TLNSSTATPVSPGSVTKETTTVIVTTTKSLPSDQVMLVYDQQEVEAIFLVILVVVIIGEF
FSASSVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWGLAMLSVGIGIDYTHIEVLIDGKGC
KPPEYRNYQIVFIVFGVLMTMALIVATQFRFRYNHFKNDDSKGKEVEIPQVERNNSTESS
EETPTTTSHSQAFNFWDLIKLLCSVQYGSVLFVAWFMGFGYGFVFTFLYWHLEDLNGTTT
LFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVLPME
VLQGVTHAAIWAACISYLSAAVPPELRTSAQGILQGLHLGLGRGCGAMIGGVLVNYFGAA
ATFRGIGMACLVILLLFALIQWLAVPDEEEDKTMLAERIPVPSSPVPIATIDLVQQQTED
VMPRIEPRLPPKKTKHQEEQEDVNKPAWGVSSSPWVTFVYALYQIKEMMQLTRDNRASEI
QPLQGTNENRENSPAGRAQPVPCETHSDPSRNQPSPDAAASQTQTSPAHPSVDPCTEESE
EQQAQLAAGGH
Tissue Specificity Widely expressed. Expression levels in peripheral blood mononuclear cells are highly variable between individuals, including no expression at all.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Measles DISXSUID Strong Biomarker [1]
mumps DIS1F0X5 Strong Biomarker [1]
rubella DISXUI9P moderate Genetic Variation [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Major facilitator superfamily domain-containing protein 6 (MFSD6). [3]
Fulvestrant DM0YZC6 Approved Fulvestrant increases the methylation of Major facilitator superfamily domain-containing protein 6 (MFSD6). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Major facilitator superfamily domain-containing protein 6 (MFSD6). [12]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of Major facilitator superfamily domain-containing protein 6 (MFSD6). [14]
------------------------------------------------------------------------------------
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Major facilitator superfamily domain-containing protein 6 (MFSD6). [4]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Major facilitator superfamily domain-containing protein 6 (MFSD6). [5]
Doxorubicin DMVP5YE Approved Doxorubicin affects the expression of Major facilitator superfamily domain-containing protein 6 (MFSD6). [6]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Major facilitator superfamily domain-containing protein 6 (MFSD6). [7]
Testosterone DM7HUNW Approved Testosterone increases the expression of Major facilitator superfamily domain-containing protein 6 (MFSD6). [7]
Folic acid DMEMBJC Approved Folic acid decreases the expression of Major facilitator superfamily domain-containing protein 6 (MFSD6). [9]
Demecolcine DMCZQGK Approved Demecolcine decreases the expression of Major facilitator superfamily domain-containing protein 6 (MFSD6). [10]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Major facilitator superfamily domain-containing protein 6 (MFSD6). [11]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Major facilitator superfamily domain-containing protein 6 (MFSD6). [13]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Major facilitator superfamily domain-containing protein 6 (MFSD6). [15]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Major facilitator superfamily domain-containing protein 6 (MFSD6). [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)

References

1 Sero-epidemiological study in prediction of the risk groups for measles outbreaks in Vojvodina, Serbia.PLoS One. 2019 May 9;14(5):e0216219. doi: 10.1371/journal.pone.0216219. eCollection 2019.
2 A second dose of a measles-mumps-rubella vaccine administered to healthy four-to-six-year-old children: a phase III, observer-blind, randomized, safety and immunogenicity study comparing GSK MMR and MMR II with and without DTaP-IPV and varicella vaccines co-administration.Hum Vaccin Immunother. 2019;15(4):786-799. doi: 10.1080/21645515.2018.1554971. Epub 2019 Feb 20.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
5 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
6 Identification of novel biomarkers for doxorubicin-induced toxicity in human cardiomyocytes derived from pluripotent stem cells. Toxicology. 2015 Feb 3;328:102-11. doi: 10.1016/j.tox.2014.12.018. Epub 2014 Dec 18.
7 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
8 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
9 Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
10 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
11 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
12 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
13 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
14 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
15 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
16 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.