Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQDY90J)

• DOT Name: Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 (BAIAP2L2)
• Synonyms: BAI1-associated protein 2-like protein 2; Planar intestinal- and kidney-specific BAR domain protein; Pinkbar
• Gene Name: BAIAP2L2
• Related Disease:
  Advanced cancer
  Lung cancer
  Lung carcinoma
• UniProt ID: BI2L2_HUMAN
• Pfam ID: PF08397 ; PF14604
• Sequence:
  MAPEMDQFYRSTMAIYKSIMEQFNPALENLVYLGNNYLRAFHALSEAAEVYFSAIQKIGE
  RALQSPTSQILGEILVQMSDTQRHLNSDLEVVVQTFHGGLLQHMEKNTKLDMQFIKDSRQ
  HYELEYRHRAANLEKCMSELWRMERKRDKNVREMKESVNRLHAQMQAFVSESQRAAELEE
  KRRYRFLAEKHLLLSNTFLQFFGRARGMLQNRVLLWKEQSEASRSPSRAHSPGLLGPALG
  PPYPSGRLTPTCLDMPPRPLGEFSSPRSRHGSGSYGTEPDARPASQLEPDRRSLPRTPSA
  SSLYSGSAQSSRSNSFGERPGGGGGARRVRALVSHSEGANHTLLRFSAGDVVEVLVPEAQ
  NGWLYGKLEGSSASGWFPEAYVKALEEGPVNPMTPVTPMTSMTSMSPMTPMNPGNELPSR
  SYPLRGSHSLDDLLDRPGNSIAPSEYWDGQSRSRTPSRVPSRAPSPAPPPLPSSRRSSMG
  STAVATDVKKLMSSEQYPPQELFPRGTNPFATVKLRPTITNDRSAPLIR
• Function: Phosphoinositides-binding protein that induces the formation of planar or gently curved membrane structures. Binds to phosphoinositides, including to phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) headgroups. There seems to be no clear preference for a specific phosphoinositide.
• Tissue Specificity: Expressed in the epithelial layer of the intestine (at protein level).
• Reactome Pathway: RHOF GTPase cycle (R-HSA-9035034)

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Lung cancer	DISCM4YA	Strong	Biomarker	[1]
Lung carcinoma	DISTR26C	Strong	Biomarker	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 (BAIAP2L2).	[2]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 (BAIAP2L2).	[12]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 (BAIAP2L2).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 (BAIAP2L2).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 (BAIAP2L2).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 (BAIAP2L2).	[6]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 (BAIAP2L2).	[7]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 (BAIAP2L2).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 (BAIAP2L2).	[9]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 (BAIAP2L2).	[10]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 (BAIAP2L2).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 (BAIAP2L2).	[13]

References

• [1] BAI1associated protein 2like 2 is a potential biomarker in lung cancer.Oncol Rep. 2019 Feb;41(2):1304-1312. doi: 10.3892/or.2018.6883. Epub 2018 Nov 26.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [4] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [5] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [6] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [7] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [8] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [9] Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
• [10] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [11] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [12] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [13] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.