Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQEQSRT)

• DOT Name: OX-2 membrane glycoprotein (CD200)
• Synonyms: CD antigen CD200
• Gene Name: CD200
• UniProt ID: OX2G_HUMAN
• Pfam ID: PF00047
• Sequence:
  MERLVIRMPFSHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYTPASLKCSLQNAQEAL
  IVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYM
  CLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIE
  NSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKGYWFSVPLL
  LSIVSLVILLVLISILLYWKRHRNQDRGELSQGVQKMT
• Function: Costimulates T-cell proliferation. May regulate myeloid cell activity in a variety of tissues.
• Reactome Pathway: Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933)

Molecular Interaction Atlas (MIA) of This DOT

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of OX-2 membrane glycoprotein (CD200).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of OX-2 membrane glycoprotein (CD200).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of OX-2 membrane glycoprotein (CD200).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of OX-2 membrane glycoprotein (CD200).	[4]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of OX-2 membrane glycoprotein (CD200).	[5]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of OX-2 membrane glycoprotein (CD200).	[6]
Panobinostat	DM58WKG	Approved	Panobinostat affects the expression of OX-2 membrane glycoprotein (CD200).	[7]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of OX-2 membrane glycoprotein (CD200).	[8]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of OX-2 membrane glycoprotein (CD200).	[9]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of OX-2 membrane glycoprotein (CD200).	[5]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 affects the expression of OX-2 membrane glycoprotein (CD200).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of OX-2 membrane glycoprotein (CD200).	[11]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of OX-2 membrane glycoprotein (CD200).	[8]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone decreases the expression of OX-2 membrane glycoprotein (CD200).	[12]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of OX-2 membrane glycoprotein (CD200).	[10]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [3] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [6] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [7] The Bromodomain Inhibitor JQ1 and the Histone Deacetylase Inhibitor Panobinostat Synergistically Reduce N-Myc Expression and Induce Anticancer Effects. Clin Cancer Res. 2016 May 15;22(10):2534-44. doi: 10.1158/1078-0432.CCR-15-1666. Epub 2016 Jan 5.
• [8] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [9] Gene expression signatures after ethanol exposure in differentiating embryoid bodies. Toxicol In Vitro. 2018 Feb;46:66-76.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [12] Gene expression signature-based chemical genomic prediction identifies a novel class of HSP90 pathway modulators. Cancer Cell. 2006 Oct;10(4):321-30.