Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQJNI6K)

• DOT Name: Endosome/lysosome-associated apoptosis and autophagy regulator 1 (ELAPOR1)
• Synonyms: Estrogen-induced gene 121 protein
• Gene Name: ELAPOR1
• UniProt ID: ELAP1_HUMAN
• Sequence:
  MAEPGHSHHLSARVRGRTERRIPRLWRLLLWAGTAFQVTQGTGPELHACKESEYHYEYTA
  CDSTGSRWRVAVPHTPGLCTSLPDPIKGTECSFSCNAGEFLDMKDQSCKPCAEGRYSLGT
  GIRFDEWDELPHGFASLSANMELDDSAAESTGNCTSSKWVPRGDYIASNTDECTATLMYA
  VNLKQSGTVNFEYYYPDSSIIFEFFVQNDQCQPNADDSRWMKTTEKGWEFHSVELNRGNN
  VLYWRTTAFSVWTKVPKPVLVRNIAITGVAYTSECFPCKPGTYADKQGSSFCKLCPANSY
  SNKGETSCHQCDPDKYSEKGSSSCNVRPACTDKDYFYTHTACDANGETQLMYKWAKPKIC
  SEDLEGAVKLPASGVKTHCPPCNPGFFKTNNSTCQPCPYGSYSNGSDCTRCPAGTEPAVG
  FEYKWWNTLPTNMETTVLSGINFEYKGMTGWEVAGDHIYTAAGASDNDFMILTLVVPGFR
  PPQSVMADTENKEVARITFVFETLCSVNCELYFMVGVNSRTNTPVETWKGSKGKQSYTYI
  IEENTTTSFTWAFQRTTFHEASRKYTNDVAKIYSINVTNVMNGVASYCRPCALEASDVGS
  SCTSCPAGYYIDRDSGTCHSCPTNTILKAHQPYGVQACVPCGPGTKNNKIHSLCYNDCTF
  SRNTPTRTFNYNFSALANTVTLAGGPSFTSKGLKYFHHFTLSLCGNQGRKMSVCTDNVTD
  LRIPEGESGFSKSITAYVCQAVIIPPEVTGYKAGVSSQPVSLADRLIGVTTDMTLDGITS
  PAELFHLESLGIPDVIFFYRSNDVTQSCSSGRSTTIRVRCSPQKTVPGSLLLPGTCSDGT
  CDGCNFHFLWESAAACPLCSVADYHAIVSSCVAGIQKTTYVWREPKLCSGGISLPEQRVT
  ICKTIDFWLKVGISAGTCTAILLTVLTCYFWKKNQKLEYKYSKLVMNATLKDCDLPAADS
  CAIMEGEDVEDDLIFTSKKSLFGKIKSFTSKRTPDGFDSVPLKTSSGGLDMDL
• Function: May protect cells from cell death by inducing cytosolic vacuolization and up-regulating the autophagy pathway. May play a role in apoptosis and cell proliferation through its interaction with HSPA5.
• Tissue Specificity: Expressed in normal endometrium but overexpressed in endometroid tumors.

Molecular Interaction Atlas (MIA) of This DOT

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator 1 (ELAPOR1).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator 1 (ELAPOR1).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator 1 (ELAPOR1).	[3]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator 1 (ELAPOR1).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator 1 (ELAPOR1).	[5]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator 1 (ELAPOR1).	[6]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator 1 (ELAPOR1).	[7]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator 1 (ELAPOR1).	[8]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator 1 (ELAPOR1).	[9]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator 1 (ELAPOR1).	[11]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Endosome/lysosome-associated apoptosis and autophagy regulator 1 (ELAPOR1).	[12]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Endosome/lysosome-associated apoptosis and autophagy regulator 1 (ELAPOR1).	[10]

References

• [1] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [2] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [3] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [4] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [7] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [8] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [9] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.
• [12] Cellular reactions to long-term volatile organic compound (VOC) exposures. Sci Rep. 2016 Dec 1;6:37842. doi: 10.1038/srep37842.