Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTQNA67C)
| DOT Name | Cell growth-regulating nucleolar protein (LYAR) | ||||
|---|---|---|---|---|---|
| Gene Name | LYAR | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| PDB ID | |||||
| Pfam ID | |||||
| Sequence |
MVFFTCNACGESVKKIQVEKHVSVCRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGG
KGYEGKTHKGDIKQQAWIQKISELIKRPNVSPKVRELLEQISAFDNVPRKKAKFQNWMKN SLKVHNESILDQVWNIFSEASNSEPVNKEQDQRPLHPVANPHAEISTKVPASKVKDAVEQ QGEVKKNKRERKEERQKKRKREKKELKLENHQENSRNQKPKKRKKGQEADLEAGGEEVPE ANGSAGKRSKKKKQRKDSASEEEARVGAGKRKRRHSEVETDSKKKKMKLPEHPEGGEPED DEAPAKGKFNWKGTIKAILKQAPDNEITIKKLRKKVLAQYYTVTDEHHRSEEELLVIFNK KISKNPTFKLLKDKVKLVK |
||||
| Function |
Plays a role in the maintenance of the appropriate processing of 47S/45S pre-rRNA to 32S/30S pre-rRNAs and their subsequent processing to produce 18S and 28S rRNAs. Also acts at the level of transcription regulation. Along with PRMT5, binds the gamma-globin (HBG1/HBG2) promoter and represses its expression. In neuroblastoma cells, may also repress the expression of oxidative stress genes, including CHAC1, HMOX1, SLC7A11, ULBP1 and SNORD41 that encodes a small nucleolar RNA. Preferentially binds to a DNA motif containing 5'-GGTTAT-3'. Negatively regulates the antiviral innate immune response by targeting IRF3 and impairing its DNA-binding activity. In addition, inhibits NF-kappa-B-mediated expression of pro-inflammatory cytokines. Stimulates phagocytosis of photoreceptor outer segments by retinal pigment epithelial cells. Prevents nucleolin/NCL self-cleavage, maintaining a normal steady-state level of NCL protein in undifferentiated embryonic stem cells (ESCs), which in turn is essential for ESC self-renewal.
|
||||
| Tissue Specificity | Predominantly expressed in testis. | ||||
Molecular Interaction Atlas (MIA) of This DOT
|
2 Disease(s) Related to This DOT
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
17 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
3 Drug(s) Affected the Post-Translational Modifications of This DOT
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
