Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQO6JIL)

• DOT Name: Cilia-and flagella-associated protein 96 (CFAP96)
• Gene Name: CFAP96
• UniProt ID: CFA96_HUMAN
• Pfam ID: PF15239
• Sequence:
  MPAEGGKTDMERIGLFSEMEYITVGDKYVSQFNRPFNEAASKNKQMLPGGSKEMSDLQAG
  YFDPHFVRIFEGEGYINLNQVRRRDMVEAAKKNLGKAFLPSNGEKKPCGLGSYYGTIGGP
  VPFFSAQSKPREKYKAPGKNLYTNPGKKGTGYGYANITIGKQFSHSADFYDAAKLKYKKA
  NEEHHRLLKGAPFKLNLHPRDYFDANPYFSEESLPPIKKEEKKKTISNTFKPSSPGKKPG
  GMKAGTFDPYPSHSADPYVAKLANISGKDDKIFHPPSGPKSRPVESIMTLNVRRALNSKN
  YKTSSVPSY
• Tissue Specificity: Detected in testis and fetal liver.

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Cilia-and flagella-associated protein 96 (CFAP96).	[1]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Cilia-and flagella-associated protein 96 (CFAP96).	[2]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Cilia-and flagella-associated protein 96 (CFAP96).	[3]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Cilia-and flagella-associated protein 96 (CFAP96).	[4]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Cilia-and flagella-associated protein 96 (CFAP96).	[5]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Cilia-and flagella-associated protein 96 (CFAP96).	[6]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Cilia-and flagella-associated protein 96 (CFAP96).	[7]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Cilia-and flagella-associated protein 96 (CFAP96).	[6]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [3] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [4] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [5] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [6] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [7] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.